SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022115 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022115
Domain Number 1 Region: 35-199
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-43
Family RUN domain 0.0000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022115   Gene: ENSTNIG00000018928   Transcript: ENSTNIT00000022352
Sequence length 443
Comment pep:known_by_projection chromosome:TETRAODON8:2:7904452:7908156:1 gene:ENSTNIG00000018928 transcript:ENSTNIT00000022352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRASSSSSWMLSGPVQAAMAMGDVSRTASARNVAVERKNLLTVCRFSVKTLLEKYTAEPL
DDSSEEFVNFAAILEHILTHRFKGRRPGSGSWFDGQRSFWDYIRVACAKVPNSCISSIEC
MENISTSRAKGRAWVRVALMEKRLSEYIATALRDSRTTRRFFAEGAILLREEATVLTGML
LGLGAIDFSFCLKGEALDGKSPAVIDYTPYLKFTQSYDYLSDDDDRGSVDSSTSDDSIPE
HPYVPLVTDEESWSTKCRKMEQRFKIVNAQKGYLEELVRLRESQLENAELENKKLKARLE
ERQSRSLQEKRELEAVVLELQEQLTSLIPCDSTHLTKNRSTPSINPWPTLEPYNNHEVRL
FRRRSFPSTELLSVEISLDSDSQRMEGTQNGGAWCTEKDYTPSMMGLCGSLASLPSCKSL
ASLKSSECLVNISTENSPALSPS
Download sequence
Identical sequences H3DNL6
99883.ENSTNIP00000022115 ENSTNIP00000022115 ENSTNIP00000022115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]