SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022119 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022119
Domain Number 1 Region: 718-1006
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-74
Family Protein kinases, catalytic subunit 0.000000000941
Further Details:      
 
Domain Number 2 Region: 339-532
Classification Level Classification E-value
Superfamily L domain-like 4.82e-43
Family L domain 0.0000137
Further Details:      
 
Domain Number 3 Region: 49-211
Classification Level Classification E-value
Superfamily L domain-like 4.25e-36
Family L domain 0.0000516
Further Details:      
 
Domain Number 4 Region: 518-644
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-19
Family Growth factor receptor domain 0.00000768
Further Details:      
 
Domain Number 5 Region: 191-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000343
Family Growth factor receptor domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022119   Gene: ENSTNIG00000018932   Transcript: ENSTNIT00000022356
Sequence length 1263
Comment pep:known_by_projection chromosome:TETRAODON8:2:7869742:7881004:1 gene:ENSTNIG00000018932 transcript:ENSTNIT00000022356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLDWRCGYTLTFSLLTVSSGSAQSACMGTDMKLSLPSSLENHHEMLRLLYTGCQVVHGNL
EITHLHGTPDLSFLQGIVEVQGYVLVAHVSVSLLPLDNLRIIRGSQLYNSSYALAVLDNT
LDGRGLRTLHLRSLTEILFGSVYVWGNPQLCFPDPQSINWRDILDQQNTDTRHRLQPRAQ
NCERRDSRSGPNCSSQCLTSCWGEAAQDCQTFKVTRSNCASGCQRCKGFLPNDCCHKQCA
AGCTGPKDSDCLACRHFNDSGVCKENCPPPTTYDPATFQSKPNPDRKFSFGATCVKTCPY
NYLAMDVACTLNYPKPNPKDVVPQPCGNDTQKCEKCEGDCPKVCYGPGMDDHGAVDSSGS
TMVTAANVGQFNKCTKIFGSLAFHSQSFSRDPVTNASGLSPEQLSVFRNLEEITGYLYIE
AWPQEWMNLNVFDNLKVIRGRMLYKGVFSLAIQNLQITSLGLRSLRSISGGLVLLHNNSQ
LCYTSSLPWESIVHPTQGPHRIVSKNLDPQICEKQGHVCHRLCKGGCWGPGPGQCASCET
FQRGTECVEHCDIYQGSVREYASESLCVACHPECQPLNGSASCHGPGAEHCVECRKFQDG
DFCVDHCPSGVKEDHQTVWKYSNATGHCLPCNTNCTLSCTVKDERGCPVDTRAGLGTTIA
AAVGGVVLFFILLGLLFFYLRRQKKLKRKETMARILQEHELVEPLAPSGASPNQAQMRIL
KETELKKLKVLGAGAFGTVYKGVWAPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMA
GVASPYVCRLLGICLTSTVQVTQLMSYGCLLEYVRKNKDHIGSQLLLNWCVQIAKGMSYL
EEVRLVHRDLAARNVLVKNPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILQ
RKFTHQSDVWSYGVTVWELMTFGAKPYDMIPARDIPEVLEGGERLPQPPICTIDVYMIMV
KCWMIDPDYRPRFKDLVKEFTTMARDPPRYVVIQNEEQMGTPSPVDNQFFRLLVEEEGNN
LRELLDAEEYLVPQPNHFPRTHENGIQSNGPSRHQSYRSTLSRSQYPTLPLGASAANGVW
SPPYPMLARSPSAGEQSDSVFLESPDDPSLPPASPNRYCRDPTYSNDNQGDLETDGPGFH
LPQHSHHSLPRQSHRNHVLPGEPDGDLPPPHPRPGILERPTTLPRKGSRADRRLPNGLSS
GHSVENPGYLIPFTARTPTSPAFDNPYYLDHLAKAGGAMPRHVNGFVTPTAENPEYLGLA
DTL
Download sequence
Identical sequences H3DNM0
99883.ENSTNIP00000022119 ENSTNIP00000022119 ENSTNIP00000003640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]