SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022156 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022156
Domain Number 1 Region: 20-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.48e-63
Family BAR domain 0.00039
Further Details:      
 
Domain Number 2 Region: 246-351
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000103
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022156   Gene: ENSTNIG00000018968   Transcript: ENSTNIT00000022394
Sequence length 352
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:10769921:10772485:1 gene:ENSTNIG00000018968 transcript:ENSTNIT00000022394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFNMDFNVKRLAADAGTFLSRAVQFTEEKFGQAERTELDAHLENLLVRAESTKVWTERIM
KQTEVLLQPNPTDVRLEEFVYEKLEKKAPTRMNNHELLGQALMDSGSECGPGTAYGNALM
KCGEAEKLIGGAEREFMQGAAINFLTPLRNFLEGDFKTILKERKLLQVRRLDLDAAKTRL
KKARLAEARAAAEQELRVTQSEFDRQAEITRLLLEGISSTHAHHLRCLNDLVEAQSSYYA
QCYQYMVDLQKQLGSFPSSFTNNNQASVSGGAGASAPTIAVSSSLSELRGSGASRRARVL
YDYDAASSSELSLLADEVITVSSVPGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences H3DNQ7
99883.ENSTNIP00000022156 ENSTNIP00000022156 ENSTNIP00000022156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]