SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022207 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022207
Domain Number 1 Region: 22-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-33
Family SPRY domain 0.0091
Further Details:      
 
Domain Number 2 Region: 264-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000277
Family Nucleotide and nucleoside kinases 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022207   Gene: ENSTNIG00000019016   Transcript: ENSTNIT00000022445
Sequence length 590
Comment pep:known_by_projection chromosome:TETRAODON8:16:6159758:6165573:1 gene:ENSTNIG00000019016 transcript:ENSTNIT00000022445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGGHYSRKRPYEESRSYSYYEHREEKRTSFSRSRTPQPPAEDEEENIDDSLVTIDTYNC
DLHFKVSRDRYSGYPLTLEGFAYLWAGARATHGVIQGRVCYEMKINEEIPVKHLPSSEPD
PHVVRIGWSINHSSTQLGEEAFSFGYGGTGKKSENCKFSDFGEKFGENDVIGCYIDFESG
EEVEMSYSKNGVSLGVAFRTTKEALAGRALFPHVLVKNCAVEFNFGQKSQPYFPPPEGYT
YIHNLEMEDKIRGTKGPGTKSECEILMMVGLPACGKTTWAVKHAEENPEKKYNILGTNAI
MDKMKVMGLRRQRNYAGRWDILIQQATQCLNRLIEIAARKRRNYILDQTNVYGSARRRKM
RPFEGFQRKAIVIFPTDEDLKERTLKQTNEQGKDVPDHAVLEMKANFTLPETCDFLEAVT
FVELQRDEENLLKQYNEEGRKAGPPPDKRTAGRAGSEVRGGGSYQRYDNRDYSRGGYQNR
SGDGGSGYRGGYSRGGYSQSRWGSSYRDGGSDSRSGYSRNQQSGGSYNRPAPYNKGGYSQ
GYNQGNYNQNYYGNYNQYPGYSQSYYAQQWQQYYQNQNQWNQYYSQYGSY
Download sequence
Identical sequences H3DNV8
ENSTNIP00000022207 ENSTNIP00000022207 99883.ENSTNIP00000022207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]