SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022228 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022228
Domain Number 1 Region: 31-314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.22e-83
Family Regulator of chromosome condensation RCC1 0.0081
Further Details:      
 
Domain Number 2 Region: 353-464
Classification Level Classification E-value
Superfamily POZ domain 6.28e-20
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022228   Gene: ENSTNIG00000019037   Transcript: ENSTNIT00000022467
Sequence length 529
Comment pep:known_by_projection chromosome:TETRAODON8:16:5853493:5857409:1 gene:ENSTNIG00000019037 transcript:ENSTNIT00000022467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDVGKWPVFALLPPEELRLIRQACVFGSAANEAIYVTVNDEVFALGTNCSGCLGLGDLQ
STIEPRRIDALCGKKIVSLSYGTGPHVAIATADGEVFSWGHNGYSQLGNGTTNHGLTPAL
VSTNLLGKRVIEVACGSHHTIALTTDGEVFAWGYNNSGQVGSGSTANQPTPRRVSSCLQN
KAVVNIACGQLCSMAVLDSGEIYGWGYNCNGQLGLGNNGNQQTPCRIAALQGVSVIQVAC
GYAHTLALTDEGFVYAWGANSYGQLGTGNKCNQALPTLINTDKERMAEVAACHTSHTSAA
KTQSGQVLMWGQCRGQAVASPHLTHFSSTDDVFACFATPAVTWHLLSIDTEDYLTVAQSL
KKEFDSPEISDLKFLVDGKCIHVHKALLKIRCEHFRSLLNESDEDCIEVSQFSYLVYRAF
LEYLYTDAINLPPEDAIGAGLLDLATFYREMRLKRLCQETIKRGISEENAITLLSAAVKY
EARDLEEFCFKFCVNHLTAVTQTHAFADMDHELLKNFISKASRYGAFKN
Download sequence
Identical sequences H3DNX9
ENSTNIP00000022228 99883.ENSTNIP00000022228 ENSTNIP00000022228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]