SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022231 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022231
Domain Number 1 Region: 1281-1335,1389-1572
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000000111
Family SGL-like 0.083
Further Details:      
 
Domain Number 2 Region: 704-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022231
Domain Number - Region: 834-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 804-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 737-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 670-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.004
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 863-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0383
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 771-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0819
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022231   Gene: ENSTNIG00000019040   Transcript: ENSTNIT00000022470
Sequence length 2661
Comment pep:known_by_projection chromosome:TETRAODON8:16:5682465:5751760:-1 gene:ENSTNIG00000019040 transcript:ENSTNIT00000022470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKERRPYRSLTARQDTEHRYTSSSADSEDGKANPKSYSSSETLKAFDHDSRMAYGSRV
KEMVHHEVDEFSRQGVDFSLRNLGFGEALPSHVATYRSDMGLPHRDYSVSAGSDPDTETD
GIMSPEHAVRLWGRSNTKSGRSSCLSSRANSNLTLTDTEHENTENGPPLHCSSASSSPVE
QLPYPPPSIAANESQGGLLGNSAAQPAQDSDSEDEFGPNSFLVKTGSGNLYTPATAAAEE
GAFQNHSRLRTPPLPLSHSHSPSHQHHAASINSLNRSNYTQRSNPSPAPTDSSVPPEGPA
SQDSVSVQDNWLLNSNIPLETRNIAKQSFLETLQDNLIEMDILASSGRDASYNDGQFLFK
PGGTSPMYCTTSPGYPLTSSTVYSPPPRPLPRNTFSRPAFSLKKPYKHCNWKCAALSAIL
ISVMLLFLLAYFIAMHLFGLNWHLQPVQRQMYQLSEDNTSGLPFPTDLSVSPVGNTGLVI
PERRGKDDSKLDSLFPDDSYIDMGEIDVGRKVTQQIPPGVFWRSQVFIDHPMYVKFNVSL
SKDALVGIYGRRGLPPSHTQQFDFVELLDGRRLLVQDIRGVEGPAAMQRGLIPITTHDTG
FIQYMDSGIWHLAIYNDGKETETVSFLTTATDSIDDCPSNCFMNGDCIAGKCHCFLGFKG
PDCGRAACPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDIACSNHGTCIVGTCICN
PGYKGENCEEVDCMDPTCSGRGVCVQGECHCFVGWGGSGCESPRASCMDQCSGHGAFLAD
TGTCSCDPNWTGHDCSTEICAADCGGHGVCVSGSCRCDDGWMGSGCDQRACHPRCNEHGT
CKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNNGWYCVCQLGWRGTGCDTSMETAC
TDVKDNDGDGLVDCMDPDCCLQATCHTTALCVGSPDPLDIIQETQLSSTQSKLQTFYERV
RFLVGRDSTHVIPGVNPFDGKLHKCITAFLVFFCLFFANDNFIGRQPPSFHSSCLCSSFD
LVTNGGIAVALHFERAPFITQEHTLWLPWGRFFVMDTIVMRHEENDIPSCDVSSFSRPSP
LVSPASLTAFAGSCSERRSVVPEIQEEESANTQESDMKFSYLSSRTAGYKSLLRVTLTHS
TIPFNLMKVHLMVAVEGRLFRKWFPAAPNLSYDFVWDKADVYSQKVYGLSEVFVSVGFEY
ESCPDFILWEKRAAVLQGYETTASKLGGWTVDKHHALNIQSGILHMGNGENVFISQQPPV
IGSVMGNGRRRSISCPSCNGLADGNKLLAPVALACGSDGSLYVGDFNYVRRIFTTGNVTS
VLELRTLSADGPAHRFEPTEAQDGWFCISHSPLLAGLWPSYGFRGLMWPLTQDFEKKRGP
SSRIDFSMNETAGITVDKYGVIFFVDGTMIRRIDQNGIISTLLGFNDLTSARPLSCDAVM
DISQVRLEWPTDLAVSPLDNSLYVLDNNVVLQISENHQVRIVAGRPIHCQVPGIDHFIMS
KVAIHATLESANALAVSHTGILYIAESDEKKINRVRQVSTNGEIFLVAGAPSGCDCTQGQ
ELAVMTYHGSSGLLATKTNENGWTTFYEYDSYGRLTNVTYPTGQVSSYRTDADSSVRIQT
EGSNKENITVTTNLSASGTFYTLMQDQVRNSYFIGLDGSLRLVLANGMEVSLHTEPHLLA
GTIIPTVSKRNITLAIDNGLNLVEWRQRKEQARGQVTVYGRRLRVHNRNLLSLDFDRITR
TEKVYDDHRKFTLRIHYDHAGRPTLWAPSSRLNGVNVTYSPGGNVAGIQRGTMSVRMEYD
QTGRITSQIFADGKSWTYTYLEKSMVLLLYSQRQYIFEFDKNDRLSSVTMPNVARHTLET
SRSIGYYRTTYQPPEGNASVLQDYSEEGQLLQTTYLGTGRRVTYKYGKIAKLLEMLYDTT
RIGFYYDELTGMLKTVNLQSEGFTCTVRYRQIGPLIDRQIFRFSEEGMVNARLDYVYDNS
FRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAY
GRVKEVQYEIFRSLMYWMMVQYDNMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSIN
DKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDNRDRITRLGDVQYRMDEDGFLKQRGNDY
FEYNSAGLLVRVYNKVSGWSIQYRYDGLGRRVSSRSSIGHHLQFFYADLSSPTRITHMYN
HSSSEIASLYYDLQGHLFAMELSSGDEFYVACDNIGTPLAVFSGAGIMIKQILHTAFGEV
YLDTNPSFQLIIGYQGGLYEPLSRLVHMGKRDYDVLAGRWTTPNLEIWKRLNSKHIAPFN
MYMFKNNNPLSNNEEIKCYMTDVNSWLVTFGFQLYNVIPGYHKPNTESMEPSYELVRTQI
KTQEWDSTKSLLGVQCEVQRQLKAFVKLERFGQIYGAKSAGCPQTETKHIFATMGSIFGK
GVKFAIREGRVSTDIISLANEDGRRMAAVLNDAFYLEHLHFTVAGMDTHYFVKMGPVEGD
LSLIGMTVGQRTLETGVNVTVSQVNAVLNGRTRRITDIQLQYGTLYLNTRYGSSVDEEKA
RILEMARQRAVTQAWARERQRLRDGEEGSRTWTEGEKQQLLGSGKVQGYDGYYVVSVDQY
PELADSVNNIHFMRQTEMGRR
Download sequence
Identical sequences H3DNY2
ENSTNIP00000022231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]