SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022237 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022237
Domain Number 1 Region: 5-292
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.01e-65
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 400-583
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00000322
Further Details:      
 
Domain Number 3 Region: 266-373
Classification Level Classification E-value
Superfamily PH domain-like 7.34e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 772-827
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000184
Family SH3-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022237   Gene: ENSTNIG00000019046   Transcript: ENSTNIT00000022476
Sequence length 828
Comment pep:known_by_projection chromosome:TETRAODON8:16:5565798:5593576:1 gene:ENSTNIG00000019046 transcript:ENSTNIT00000022476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTLEFTDSFLDSPDFRERIACHEIELERTNKFIKELIKDGNMLMAAFRINNINVCKN
MFRFLLNDLLKSCFSPAKHDDPVCAARQSFKEFSQLLNMVEEERRRLIQNADDVLITPLE
KFRKEQIGAAKEGKKKFDKETEKYYSTLERHLNLSSRKKEAYLQEADMQIDKERQLFYDA
SLEYVFKIQEVQEKKKFEFVEPLLAFLQGLFTFYHEGYELAHEFEPYKQQLQFNLQNTRN
NFVSTKQEVEKLMKRIRSADQDCKPPGQWTMEGFLYVQEKRPLGCTWTRHYCTYDKSSNT
FTMSATENKSAAKQNGLVLNQPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGVMTLQAL
SESNRRLWLEAMDGKEPIYNLPAILSKKEETFLNEAGFNFVRRCINLVEARDYEGINTMG
LYRIGGVNSKVQKLMTTVFYLPRLLWIWTWIQRCGDNKTITSGLKNYFRCLSEPLMTFKL
HKDFIMAVKSDDQNYRVCAVHALVHKLPEKNREMLELLIKHLVTVSAQSQLNLMTVSNLG
VIFGPTLMRSQEETVAAMMNIKFQNIVVEILIEYFNKIFQQPPDANVPLPQPQSRPNSRR
NRAICLSTGPRKPRSLYTPTLCLADAESDTLSSSPSSTPMGSLESLSSHSSEQNNSSKMA
PSAQHHTQTLFCPQESPPLSQSPQPRHDTNSPKVPSWSLILCAVAILPWLYVYKMNKFSS
FITIFSALICFRVAARALLFEHTSIHPYFTLLIPFLSSETDHAFFVCFYCLFRDAKAMYS
CEAEHSHELSFPQGAHFTNVYPSVEPGWLQATYEGRTGLIPENYVVFL
Download sequence
Identical sequences H3DNY8
99883.ENSTNIP00000022237 ENSTNIP00000022237 ENSTNIP00000022237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]