SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022352 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022352
Domain Number 1 Region: 113-244
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-31
Family C-type lectin domain 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022352   Gene: ENSTNIG00000019155   Transcript: ENSTNIT00000022591
Sequence length 245
Comment pep:known_by_projection chromosome:TETRAODON8:14:1562782:1564210:-1 gene:ENSTNIG00000019155 transcript:ENSTNIT00000022591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDDWFLSQTSLPERKKARGDVPDAHPDPHPVSEPTSPVSDFENSYNYVLSRLAGVDQTIH
KLTVGHYTLDVKVSQLIDRLSTMDAKVLELEDSIREVFQHSKTNRKETGRLEGCQKGRRI
GYKCYLVYNSYEDYAGASRKCLERGGRMAMPRDRKEQEALADYVKAFFHPGNWPVWLGIN
DLQSEGTYLYDDGAQVSYFQWRKHFLSSQPDGGRRENCVAMASDDGDWWDHYCDRAMNYV
CEFDD
Download sequence
Identical sequences H3DPA3
ENSTNIP00000022352 99883.ENSTNIP00000022352 ENSTNIP00000022352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]