SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022394 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022394
Domain Number 1 Region: 76-243
Classification Level Classification E-value
Superfamily vWA-like 5.98e-26
Family Integrin A (or I) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022394   Gene: ENSTNIG00000019197   Transcript: ENSTNIT00000022633
Sequence length 913
Comment pep:known_by_projection chromosome:TETRAODON8:13:4129390:4150523:1 gene:ENSTNIG00000019197 transcript:ENSTNIT00000022633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATIVLNELNWTEALEEVFKKNREEDPTLLWQVFGSATGLARYYPASPWMDARKTPSKIDL
YDVRRRPWYIQGAASPKDMLILVDASGSVSGLTLKLIRTSVTEMLETLSDDDYVNVVYFN
TQVKKTACFDHLVQANVRNKKLLKDAVQNITAKGITNYTKGLEFAFEQLSVTNVSRANCN
KIIMLFTDGGEERAQAILEKYNADKKVRIFTFSVGQHNYDKGPIQWMACSNKGYFYEIPS
IGAIRINTQEYLDVLGRPMVLADKQAKQVQWTNVYLDALELGLVITGTLPVFNKTKSKDD
RNGEYQNQLILGVMGIDVSLDDIKKLTPRFTIGPNGYYFAIDPNGYVLLHPNLQPKNPKF
QEPVTLDFLDAELENDIKVEIRRMMIDGETGERTIHTLVKSQDERYIDRGVRTYTWAPVN
GTDYSLALALPKYSEHFIQAKLGDDIKQAMLKTGNFKAMETLQLERFDEYGYTFISPREY
CKELKLSLNNTQFLLDFNQYIDRYTPNACNVSLVSRLILDAGLTAELVKVWSEQTVDGIV
ARFVATDGGVTRVYPRSAGEDWIENPETYESSFYKRTLDNDIYIFTAPSFNTENRDSVSE
SGILVSRAVELTIDEVTLKPAVVGVKLNVSFWMNSFMNATLKLNCKDEICGCLRNDKHVD
CVILDDGGFLLLSNQDEYISLIGQFFGEVDPVLMINLVNTSLYSFNKTYDYQSVCDPEKD
SKAAAGPRSVYVPSIADLLSVGWWASSAAWSILQQLLIGLMFPNLLEAAEPADEDIPDAM
FKESCITEQTQYFFDNEERSYSGVLDCGNCSRMYRAEKLPNTNLVFLITDAKATCLSCDP
RPLKQAEQPSEGPDPCELAQNPRYRKGPDVCFDNNENEDDSDCGGGTFLSPCLWPMLGLQ
LLLLWLLLSSRPL
Download sequence
Identical sequences H3DPE5
ENSTNIP00000022394 99883.ENSTNIP00000022394 ENSTNIP00000022394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]