SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022405 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022405
Domain Number 1 Region: 156-278
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-17
Family Cadherin 0.0045
Further Details:      
 
Domain Number 2 Region: 288-398
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000113
Family Cadherin 0.003
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022405
Domain Number - Region: 391-500
Classification Level Classification E-value
Superfamily Cadherin-like 0.00628
Family Cadherin 0.0071
Further Details:      
 
Domain Number - Region: 76-168
Classification Level Classification E-value
Superfamily Cadherin-like 0.00885
Family Cadherin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022405   Gene: ENSTNIG00000019208   Transcript: ENSTNIT00000022644
Sequence length 873
Comment pep:novel chromosome:TETRAODON8:13:3784131:3789215:1 gene:ENSTNIG00000019208 transcript:ENSTNIT00000022644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSDEDMGTNEDALEDLTTGCSGSSEPRKMALTETKWNTFQAEALVWSLVAFWYLHTATG
MSGWGGCLDGQDVFGMIKENSHYGEVVAELMVDSTENVWWSLDGKDADWFFLEDSSIRLN
TSVERVLDREVQGPILVASLRCHEDDMIQSTYRIMVEILNANDNLPVFQDRADLTVHLNE
LTPVGTVVFSVQATDADNDKIIYFIDQTSPDAEYFKIELPNSGEVILSKPLDYESKDLLT
VTILASEMNTAEHFNTSTSLTIRVLDGDDQYPQFLPCVLLFQDESSRICTSPVYTVNVTE
GEEDVVLDLSPGPIQAVDGDRGLRAPISYAILSGDDGGCFQLDRETGEMRLVRGVKDRLA
SPTLHLNIMAYQQDDPRKYTVATVLVRVLAVNHFRPEFEKKEYRGFVTAGKTVASLVNTY
GGKALKLHVQDQDFIHASNPMIHFTFAPASNHTSIYQITQEGLLVAKTNKLEPNQKHVLE
VMGVDQESGDAAFASVVVEVLAEGELVPYTVLAEEHVISCTVGKALFLCTVVLTALGCIV
SLGMWLKKRHRGKRNPLERGCVAQGKHPNVSLQWFQLVKSSFTETSGMYTLHAIPPGPGS
DPPRVTATPDTHVTAMEAVRKPTNNISPSSRSATVDVSSPYNPPPEEKNASSPDSEAQAN
TSPGSVTFDLTPCTCLDSEPMETTAGDDLINPAASPSSQCSIPWSKTRIASAEIEKPLCK
PCVKTPPDSPPQPSPIPRLACTPPPTPDQASLKATLVQIETCSIDTPLATPTLTFTRLGI
EVAQFSTPLDETDQSQLPAEAAGAGGPARDRRPSANSGDRQDGHQAGGGEDDGFLGDEEA
DRSNEGEDEFELEDEALLRALMRCNPYLLTFSK
Download sequence
Identical sequences H3DPF6
ENSTNIP00000022405 ENSTNIP00000022405 99883.ENSTNIP00000022405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]