SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022424 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022424
Domain Number 1 Region: 1666-1850
Classification Level Classification E-value
Superfamily vWA-like 2.08e-33
Family Integrin A (or I) domain 0.0000547
Further Details:      
 
Domain Number 2 Region: 1242-1424
Classification Level Classification E-value
Superfamily vWA-like 8.04e-32
Family Integrin A (or I) domain 0.0000601
Further Details:      
 
Domain Number 3 Region: 1479-1654
Classification Level Classification E-value
Superfamily vWA-like 8.26e-27
Family Integrin A (or I) domain 0.0038
Further Details:      
 
Domain Number 4 Region: 617-681
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000196
Family BSTI 0.041
Further Details:      
 
Domain Number 5 Region: 265-319
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000154
Family BSTI 0.023
Further Details:      
 
Domain Number 6 Region: 2181-2237
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000119
Family BSTI 0.049
Further Details:      
 
Domain Number 7 Region: 737-798
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000507
Family ATI-like 0.029
Further Details:      
 
Domain Number 8 Region: 2553-2634
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000324
Family Fibronectin type I module 0.049
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022424
Domain Number - Region: 1117-1170
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000327
Family ATI-like 0.092
Further Details:      
 
Domain Number - Region: 796-836
Classification Level Classification E-value
Superfamily FnI-like domain 0.000366
Family VWC domain 0.042
Further Details:      
 
Domain Number - Region: 330-356
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00106
Family PMP inhibitors 0.0016
Further Details:      
 
Domain Number - Region: 679-712
Classification Level Classification E-value
Superfamily FnI-like domain 0.0942
Family VWC domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022424   Gene: ENSTNIG00000019224   Transcript: ENSTNIT00000022663
Sequence length 2797
Comment pep:known_by_projection chromosome:TETRAODON8:13:3562750:3577178:-1 gene:ENSTNIG00000019224 transcript:ENSTNIT00000022663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRCSLFGRHHIHTFDGVLYEFPGDCSYLLAGDCKHRSFTLLADLVGGKRTGVTVFLGD
AFELRLSVDGQLSQGDERLSLPHASHGVFVGTELGFYKLWSEEFGFSVTIDNAANIALTL
TKHHANHTCGLCGNFNANSADEYTAQEVGFLTEDSYDFANSWAVKGADQFCQRVSNRGLA
CNSSKDSSVIMSGCSKLQMSSVFLHCAHLVSPEAFLLLCQQEVCHCDQKGGEDCYCPFLL
EFARTCHAHGILLHGWQEESQCFPKCPIGMQYSECTKSCSTTCHSLNIQEVCKEDCVDGC
RCPVGKVLDGTRCVEVSQCSCVHMGRHFLSGSTISQDCNTCVCRHGSWECTNEGCPGECL
VVGQSHFKTFDSKFFTFTGRCHYLLARDCADNSFSVIIENVQCADDEDAVCTRSVTLSLP
ILEDMTIKLKHGGVVAVNNMDIQTPMHHGHLHIQRSLQSVHVRFGDDLRLHWNGRGRVLL
KLGPQWAGKTCGLCGNYNGNQGDDFLSGSGLVEAGPQSFGQSWRINGDCESSHKYGTDPC
AVNPKRVRFAEEACSVILSDVFSACHFLVNPGPFQRFCRYDVCACADSEECLCSALSAYA
SACAARGVLLSWRSHSLCEMECTGGQVYETCGSVCERTCRSLSGVEPECNGEKACEEGCF
CPAGKYLSDSGECVAAELCTCLHDGQLYQPNDVYADHNSICYCEKGAMHCSSPETSSSLS
DLFYDDDFPLSRVRRSVQCAPGLIRLNCDTGENGIECARTCQNLDLPCVTTACIPGCLCP
PGTVRYRKNCIAPEQCPCFHNNRPYASGQTISVDCNTCVCENRRWRCTEKLCDGVCRTLG
EGHYISFDGLKYSFPGPCQYVLVQDMCNGEEGSFRVLVENEPCGLVGRRCKKAVTIFYQG
GVIVMRDGEVKMKKPVMQESQVEIIRSGQFYTLLLGKQISISWDKGTRLLVHISSTYRGR
VCGLCGNFDGNVNNDLMSSNNQLEVDSLHFGNSWKVVPSCADVTQVSSGLKVQEPCSQNI
AKLVTVEQSCRVILSSLFKECNSEVDAEPYMDMCVEAACSCSSVDDCACFCDVIAAYAQV
CSEKGVTISWRSNDLCPMSCEEMNPKNSVSGEELCQWRYNTCGPACPITCQHPNPLHCSL
SCVEGCHAYCPPEGQLLDEVAMRCVNPSDCKVCVHEGQRISHGNKVILNRDDPEHCKICH
CDNNTLSCEVCTSLDMFTTPAPIPTYATFTTSPFTTLVPEGLCDRAMDLAFLLDGSEALS
EDEFRTTKDFILAVIERFRMGSAHTRATVLLYHSGVKTYDLQVQKWLFKKSVNELHYTGG
DAAFLDEAIKYLVINIYDKNKRENSGRVAIILTASANPRSVRGIIRMLKKKDITTLTVAM
GPGINMKQINDITNVSPDNRAYVLGSVGELNDHLLGLTDYLCTLGMEPEVPKPTLPFSPL
GKKPPRITTTTLSPGLEPNPTSPTGLSPATTSSSLPTKEVTFIIEGSKSVGEVNFNQTLT
FLEEVISQLTEKEQVIRITVIQYSTTVTVEISRWELRQQRALLLQRLREIRWMGGSKTNT
GAAVKTFQEMSTSQQSGRPTPPQLAFLITENPPTDTVMRPTSTQTHVYPIGVGPKVQEGD
LFPFSSPHRPLMAADYNHLWTLVHRVVNITHSTVMPRSPTLPPLVPCKKPMDIMFLLRAG
DQLEDMKTFVKAFINMADIGANGIQVSVVQYGATNSQEVTWKDEQTKPNLLNLVERIPRR
TAAAPALGSALRFAVQTATSSVSGGRVGVSKAVVMLVTDTSTDDVKEAANAALAAGVLVF
PIGVGANYDRNELTVLGHHRNQDNTLHLNSMDQLLMLLSLDHSYIERICRAGPAVCIDDD
GNERKPGDTWLLEDGCHSVLCHPSGAVTVQTRKVSCDTQELPSCSNNMPPVRVQDTCNCR
WECPCMCMGSSTNHVVRFDGLALRLDREGLCTYTLLTVSRGLSQGSEVKLHNGPCQLSNN
YNRVCMKAIEVNHGPHRLLLKDDVTATINGEEIALPWRYAGLELVCYGGVMLLLKAEQDY
VLSFTPQSNEFTITVPSSANLGHTAGLCGACGEDKLNVLSLRNGSTTTDQPGFVSDWADD
KDGLTCVSTKKAVCAAGAAMGCQALRSEVFEPCHAHIPVQVFLAKCEEQACEQSDVCELI
SAYARLCRERHVCIDWRSPHLCPLQCPTSMEYDACRTGCVEDCRGNQSACMDTPTEGCFC
TGGTVLHHGRCVSPEACRQCVDQQGHTYAYMQSWVPKENPCLICMCLDQQHINCTARPCN
DIKAPVCGPCEVLREKRDSKCCPEYECVCDQVNCELPEAPHCEDGQTVVLKNPGQCQPVH
ECVCKKEECPPQALSDCPAHRLLSVKKTKCCDVLECVCNCQNSSQSCAAGFITTSSTNDC
GCTETSCLPDNVCVVGVMVHPVGSTWEEGCEKCSCTQLKDKNTSLHLAQCTPPVCDRTCP
LGSTYTQLNGECCGKCKPTSCVESKGEMRGDSLTGAKFRRVGEVWRSPLDKCVLQQCVKV
NDELFISATNVSCPPVETQSCPLGTELRCDMQDCCPWCHCAHLDACVLNNTLIGAGERFI
IDVCTHCECLVVDGAVREYKLSCKKINCPTCPLGYTLQKEEDACCGRCVPTACFIKKPDG
NQISVQVNATLEEGCSAYACRVNRKGDLVLEAKVTTCPPLDRQACLDQGGKLSKIGTTCC
EMCSEPECRTTVGTLNYIKVDDCRSENQIKLHYCEGKCRSKSIYSLEKAAVEQQCVCCSA
VKTEPLSVAILCSNGTRAHHTVLSVTECDCLSRQCIK
Download sequence
Identical sequences H3DPH5
ENSTNIP00000022424 ENSTNIP00000022424 99883.ENSTNIP00000022424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]