SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022440 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022440
Domain Number 1 Region: 2-467
Classification Level Classification E-value
Superfamily Sema domain 8.37e-161
Family Sema domain 0.00000000275
Further Details:      
 
Domain Number 2 Region: 468-516
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000785
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022440   Gene: ENSTNIG00000019240   Transcript: ENSTNIT00000022679
Sequence length 663
Comment pep:known_by_projection chromosome:TETRAODON8:13:2825959:2832243:1 gene:ENSTNIG00000019240 transcript:ENSTNIT00000022679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRFSASGVVNFTTLHLSEEDKMLYVGAREVLFALNLSDISQVTLQRNVTWKTPDKKREEC
SFKGKDLQKDCFNYIKILLRVNSTHLYVCGTYAFSPTCAYIKTANFSLVKNDAGEVVTED
GRSRCPFNPEYKSTAIIADGELYAGTVSNFQGNEPIIYKTLSQGTSLKTENSLNWLQDPA
FVGSAYIQESLPKGNEVGDDDKIYFFFSEVGKEFDFFDNTIVSRIARVCKGDLGGERVLQ
KKWTTFLKAQLLCSLPDDGFPFNIIQDMFVLTPSPEDWKSTVFYGVFTSQWYKGGSESSA
VCSFTMDQVEQAFTGRYREVNRETQQWYTYNHPVPEPRPGMCITNEARKHGVSSSLHMPD
KVLNFVKDRFLMDSVIRSQPLLLKRNARYTQIAVHRVQTANKVYHVLFIGTDDGRLHKAI
NINKKMHIIEEMVLFRNSQPVQHIELDTEKGQLYVSSFSELVEVPVANCTNYQSCGECIL
SRDPYCAWNGRQCVDIRKYPNKAWHQSIDEADMSSVCSVVLNPRFAKSPSLRMPACQVII
IPANTFRVLPCKLRSNLAVRKWEFSKAAGHFHYPSREGGLVVVAQVDRQENYQCWSVEEG
FRQLLANYCVRGEARQEEFIILPGESRSPHMNTKTYWNELLVVCALLAFSLVVFSLFVVY
RNR
Download sequence
Identical sequences H3DPJ1
ENSTNIP00000022440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]