SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022443 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022443
Domain Number 1 Region: 12-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.8e-27
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022443   Gene: ENSTNIG00000019243   Transcript: ENSTNIT00000022682
Sequence length 528
Comment pep:known_by_projection chromosome:TETRAODON8:13:2765970:2767572:1 gene:ENSTNIG00000019243 transcript:ENSTNIT00000022682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADILELRTDGNSLLKAVWLRRLRLTRLLLEGGAYINESNERGETPLMVTCMSTHSDQQS
VSKAKIVKYLLDNQADPNIQDKAGRTALMHACMHKAGHEVVDHLLSNGADPSLEDRSGAS
ALVYAINADDKETLKLLLDACKAKGKEVIIITTGKSPSGTKTTKQYLNVPPSPGLDERSS
PTCTSPSEIEVTAFPTNKQEEQNTVFSFQAKLKSSGAAKLANGPTSPTRRPVNPKRARLP
QLKRLQSEPWGLIAPSVLAAAAAATMSRKAGSDEDVVVGVNGLSLSKRSALSRQNSVDGK
DSLFPKVGEQPCKMTPSLSVPLTSKASYERSLGQHQPLARRSTIPTEQEGGGCLSSGPPS
LRDTMHRRRLGNDHYDSDSQLYSDSGMLDSPKIPAERRKLNTSPLAMLTGSRESLDSSAG
ISSPSTVHRRIPGLLERRGSGTLLLDHISHTRPGHLPPLNVNPNPPIPDIGASSKPSSPL
ATGIRSIAPVAPNTPKRGGLKSKKKLVRRHSMQVEQMKQLYDFEEQAH
Download sequence
Identical sequences H3DPJ4
ENSTNIP00000022443 99883.ENSTNIP00000022443 ENSTNIP00000022443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]