SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022448 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022448
Domain Number 1 Region: 171-312
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-35
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 2 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-30
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-22
Family First domain of FERM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022448   Gene: ENSTNIG00000019247   Transcript: ENSTNIT00000022687
Sequence length 544
Comment pep:known_by_projection chromosome:TETRAODON8:13:2703836:2712703:1 gene:ENSTNIG00000019247 transcript:ENSTNIT00000022687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMKSQPPFTMCL
RVKFYPPEPAALKEEITRYLVFLQIKRDLYHGRLLCKASDAAMLAAHILQAEIGDYDPGK
HPEGYSSKFQFFPKHSEKLERRIADIHKTELIGQTPETSERNFLQKAQMLETYGVDPHPC
KDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTFHIYANQREDEKIILTY
FAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMELSA
KIKREPPEIHRRAALTVSLGPRMLGKALGVLPLYPALTGLQESASSSPLSGTPLPCVQPS
SPPDCAHSTPVRTVSHGESFIPRSRSQAADGGERTAVISDEAYSPSDSVLPTPVADHSTE
LSSSRQINGAPCSIEEELEAEEGGDSGDCRGAQEGAGGDSALSEVEQVNKFVLSVLRLLL
VTIGLLFVLLLLLIVLTESDLDVAFLRDIRQTPEFEQFHYEYFCPLRRWFACKLRWFLFF
FFCS
Download sequence
Identical sequences H3DPJ9
ENSTNIP00000022448 ENSTNIP00000022448 99883.ENSTNIP00000022448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]