SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022519 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022519
Domain Number 1 Region: 212-300
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-20
Family Tudor domain 0.0026
Further Details:      
 
Domain Number 2 Region: 683-756
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.86e-19
Family Tudor domain 0.005
Further Details:      
 
Domain Number 3 Region: 881-975
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.68e-18
Family Tudor domain 0.0067
Further Details:      
 
Domain Number 4 Region: 1056-1133
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.58e-17
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 415-508
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000158
Family Tudor domain 0.0064
Further Details:      
 
Domain Number 6 Region: 8-48
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000203
Family Tudor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022519   Gene: ENSTNIG00000019317   Transcript: ENSTNIT00000022758
Sequence length 1173
Comment pep:known_by_projection chromosome:TETRAODON8:10:11542341:11547674:1 gene:ENSTNIG00000019317 transcript:ENSTNIT00000022758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAGVEVTHVDEGKTEVVPVGRIRPLHEKFLRMPVVTYPCGLDGVKESETGWRKEQI
DSLKALILRRDVLATFSRHVTPAGAYGVVLYANDAACLNRCFLEKASSAADPKASRESFP
PFFLGMKVQEAPTNTGKRPPRNDAAVSNGSDSSHVQNGADSLLHLNRHSAVFLTEETAAS
EGVFAVGRSIGVKVTYVENPNKFWCQSTEKSSSLRRLMQNLQSHYAFGHPQPIVESVCVA
RSPDDGMWYRARIMAGPRSPVVDVRLVDYGAVQKVPLRDVRPIDPAFLRLSAQAFPCCIL
GGRSPSDPAATAGSPAASRKLDDPNAELRCVVKAVTVDEEGLLLNVVDIETPPDGAGKLG
ALNRVKEEGNGVQFAPGDGYDDSTPDIEAGGKETVSVTSCRSLSHFYCNLQKNAPLFSKL
NESIQQLVAQDRCKRGVFGPDRLCVAKHPDGRWCRGLAVENCGRIQVHFVDYGDTLVVKE
SDICSFPPEAAFAKSVPPQAVLLGLFDVPEDAPEEVSAWFAARAVGRTFAMSVVAKGEKG
KLMVELFDGSVNVNGLIREMTERMGRQASLGASRPADQSDQSPRGDQFRDIFVQEGEKTL
EAERRRLLDDTAGDRGSFLEEQPSFQTSAYGRPDVSPEQTREVFASCIVGPFYFWCQFNS
TQELNSISALARAAGQSQGDPRFSLGLDPGRPCLALFSDDNQWYRAQVTRRHGDRLRVVF
IDYGNEADVEVTSARALPRALLQRPPQAFLCSLGGFDESGGSWDDGVYDDFYHLLVDKPL
KLSVLKIGQHSETGLPQHLVQIECEGEDIHERMKKYWNPLSKQDFPEERPEEDTLTRDGQ
TREKSNPVVYKQAAFSRNRKEEVYASCMVGPCFFWCQYANTEDLVRISQLCQEAGQTPPD
GPAEAALPGAPCLALFSADSRWYRAQVMDGRGATVRVVFVDYGNEADVDAECVRPLPAAL
LAAAPQAFLCCLNGFEESKDSWRDDVCEDFYSLLVNKPLRATVLDTKTHPEVGIPQHTVQ
VELKDDVISGWLDVSTLMEGRCRQKARLAPGTQIRDTETVRVLIEHGARPCLKTVHGWTP
AHYAAEFGRLAVLRLLHSLHAPVDKQDPCGDKPVRIAEVYGHEDCVAFLRRAEVESQAYR
KVAAEKGISLDDSDEEWPEISKENEENRTSKPK
Download sequence
Identical sequences H3DPS0
ENSTNIP00000022519 ENSTNIP00000022519 99883.ENSTNIP00000022519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]