SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022529 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022529
Domain Number 1 Region: 124-228
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-27
Family Second domain of FERM 0.0032
Further Details:      
 
Domain Number 2 Region: 233-370
Classification Level Classification E-value
Superfamily PH domain-like 2.37e-24
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 3 Region: 15-119
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-16
Family First domain of FERM 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022529   Gene: ENSTNIG00000019327   Transcript: ENSTNIT00000022768
Sequence length 617
Comment pep:known_by_projection chromosome:TETRAODON8:10:11616434:11624329:-1 gene:ENSTNIG00000019327 transcript:ENSTNIT00000022768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNKAMQDRRCVCVFLPNDDTLNVIVNVRTLCQELLVQVCDLLRLKDCHLFGLS
VIQNNEHIYMELDQKLSKYCPKEWKREASKVRMPPLDFQGIDQFGPPMIIHFRAQYYVEN
GRLISSDRVARYYYYWHLRKQVLLSQCIQREEAYFLLAAFALQADLGNFKRNKHFGKYFE
PEAYFPPWVIAKRGREYILRHIPNMHKDQFALTASEAHLKYIKECAHLDDVTVHYYRLYK
DKKEVEASLTLGLTLRGIQIFQNVGSVRQLLYDFPWTNVGKLVFVGKKFEILPDGLPSAR
KLIYYTGCPVRSRHLLQLLSNSHRLYMNLQPVLKQVRRLEENEEKKQYRESYISDALELD
MDHLDKRCRASGSSAGSVSHHKRLSRNSTTSHGSSHTSGIETDSFRAPGQVPHRPARTCG
SSTTSHGSSHTSGVESSSKDRILDDDEIEMLVDDPKDYEELHEMALDQELCIHITEDMLT
MSPDQTSGFSGLIVKDVSSSTSSSSETVVKMRGQSIESLPQTSVCRKPPSSTDRHSQSLD
DVRLYQKDCLQWAELCQDTAHSYTFGCAQELSDSGGYQGLAEQRAGMLAEQHPFPIKRTN
KYFSLDLTSEEVPEFVV
Download sequence
Identical sequences H3DPT0
ENSTNIP00000022529 ENSTNIP00000022529 99883.ENSTNIP00000022529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]