SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022531 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022531
Domain Number 1 Region: 509-706
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-48
Family SPRY domain 0.0041
Further Details:      
 
Domain Number 2 Region: 439-538
Classification Level Classification E-value
Superfamily Fibronectin type III 8.23e-17
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 3 Region: 226-289
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000351
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 2-42
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000979
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022531
Domain Number - Region: 169-203
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0387
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022531   Gene: ENSTNIG00000019329   Transcript: ENSTNIT00000022770
Sequence length 715
Comment pep:known_by_projection chromosome:TETRAODON8:10:11649370:11665381:1 gene:ENSTNIG00000019329 transcript:ENSTNIT00000022770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMEEELKCPVCGSFYREPIILPCSHNICLACARNILVQTPDAESPQSSRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPTVPQQPPPQHLLPHPG
SLPPVPRNSCITCTQCHRSLILDDRGLRGFPKNRVLEGVVDRYQQSKAAALKCQLCEKSP
KEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRISRRASPRKISTCTEHELE
NLSMYCVQCKTPVCYQCLEEGKHGTHEVKALGAMWKLHKGQLSQALNGLSDRATEAKEFL
VQLRNMVQHIQENGVEFEACLVAQCDALIEALNRRKAQLLAQVNKEHEHKLKVVRDQISH
CTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHMTEGQWGKGTLTPRMTSDFDL
TLDSGPLLQTIHQLDFVQMKAHSTVPAAPMLQLEECCTQNNSATLSWKQPPLSTIAVEGY
ILELDDGNGGPFREVYVGTETICTVDGLHFHSTYKSRVKAFNGSGVGQYSKTLIMQTSEI
AWFTFDPASAHPDIVLSNDNMTVTCSSYDDRVVLGNSAFSRGIHYWEMTLDRYDNHPDPA
FGVARGDVRKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGVAKGTTIGILLDFSR
GIMIFLINDEQQGPVAFEGLEGVYYPAISINRNVQITLHTGLPIPDFYTPGEADP
Download sequence
Identical sequences H3DPT2
ENSTNIP00000022531 99883.ENSTNIP00000022531 ENSTNIP00000022531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]