SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022545 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022545
Domain Number 1 Region: 72-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-42
Family Galectin (animal S-lectin) 0.0000469
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022545
Domain Number - Region: 2-75
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00262
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022545   Gene: ENSTNIG00000019342   Transcript: ENSTNIT00000022784
Sequence length 202
Comment pep:known_by_projection chromosome:TETRAODON8:10:11756529:11758825:1 gene:ENSTNIG00000019342 transcript:ENSTNIT00000022784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAPTNPGWPGSAPGAPTQPSAPSPGGFPPGPGIPGQYPPGAPGQFPSSPGAPGPAPMGP
YGGPAAPGGMLMVPFDLPLHAGILPRLLITIVGEPVPGGDRFQVDFIKGPDVVFHFNPRF
HEQTIVRNSSLGGCWGPEEREGGFPFVQGRRFELKILVEEDMYKVAVDGTHLLEYEHRVG
GMEDVTLVRVTGDVRSTAPRPA
Download sequence
Identical sequences H3DPU6
99883.ENSTNIP00000022545 ENSTNIP00000022545 ENSTNIP00000022545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]