SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022575 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022575
Domain Number 1 Region: 231-429
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.86e-49
Family Reprolysin-like 0.00036
Further Details:      
 
Domain Number 2 Region: 446-522
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.18e-18
Family Blood coagulation inhibitor (disintegrin) 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022575
Domain Number - Region: 676-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00603
Family Integrin beta EGF-like domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022575   Gene: ENSTNIG00000019372   Transcript: ENSTNIT00000022814
Sequence length 709
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:96084100:96093254:1 gene:ENSTNIG00000019372 transcript:ENSTNIT00000022814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRRLSRGRLAAVVILQHLPQRGAGVVSDGGVWDWFSPAGWAGGRSAAAEVTYPTRLVQQI
DSEEETAHLHLETRVKNSTGDTSYVHLAKSVFQVEAFGHSFTLDLELNHHLLSSEYLERH
FNQDGEPSQSAGGEHCYYQGRLRGLPGSWAALSTCHGLCGMFSDGVFSYGIEPVYDGSPQ
DGAHFIRRLPDLIKAPKWLRLCSCLCPDCTEDSEPSRSKRSVRKPSVQTETKYIELMVVN
DNDMFVQLRRSSSQTKNFAKAVVNMADAIYKEQLNTRIVLVAMETWTSKNMMPVMEDPVI
TLQNFMKYRKDSIREQSDVVQLFSGRTFHSGRSGTAFTGGVCSLMRGGGINEFGNVNSMA
ITLCQSLGQNIGMRWNNARSSAGDCRCPDAWQGCIMEDTGFHLPRKFSRCSVDEYIQFLL
QGGGSCLFNKPNKLLDPPECGNGFVEPGEECDCGSQVECARSGGACCKKCTLTHDAMCSN
GLCCSGCKYELRGVVCRDTVNDCDIPETCTGDSSQCPHNVHKLDGYMCDNNQGRCYSGRC
RTHDGQCRRLWGYNSADRFCYEKLNAEGTEKGNCGPGPEGRGWLQCNKPDVLCGFLFCAN
MTMKPKFGDLQGEVTSFTLYHQNKYLDCRGGHALLEDGSDLGYVEDGTCGPNMMCLERRC
LPVAAFNLSCGGSNFGRICSDHGTCSNEVKCICDRDYTGKDCSVFDPIP
Download sequence
Identical sequences H3DPX6
ENSTNIP00000022575 99883.ENSTNIP00000022575 ENSTNIP00000022575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]