SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022609 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022609
Domain Number 1 Region: 464-582
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 129-242
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-23
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 245-349
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-18
Family Cadherin 0.005
Further Details:      
 
Domain Number 4 Region: 574-680
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.00086
Further Details:      
 
Domain Number 5 Region: 39-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.0043
Further Details:      
 
Domain Number 6 Region: 351-468
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000113
Family Cadherin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022609   Gene: ENSTNIG00000019404   Transcript: ENSTNIT00000022848
Sequence length 863
Comment pep:known_by_projection chromosome:TETRAODON8:2_random:1370801:1378493:-1 gene:ENSTNIG00000019404 transcript:ENSTNIT00000022848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEQSPQALLFLLLIHATLGQSDYAPYFYDNGASSKNGNMALFSISEDTAVGTQVYVLNGT
DPEGDPVRYGLTFEKGSKEYFRVDSKSGNVSLIQELDREKQDEISVLVSITDGRNKVVET
VRVFVTDANDEAPEFQNPPFIVAVSEDTAAGSSIYRVQAVDRDMGSGGSVSYFLQKTHNS
FPTRFTIDGHSGILRIKPSETLDYETTPTHFVTVVAKDGGGKYKGRNQVLSSTATITVNV
IDAQDMPPSFIGTPYFGYIYEVSVPGSEIITVSARDGDQGNPNPIFYSILNGSDGVFDIN
STTGCITVTTYPSLLKKELYEIKVKASEIGSNGQLPDYDVTTVTIRVVDLNNHPPTFYGE
NGPQDKFEVTMHEHPPAGEILRGFKITVNDSDQGANAKFKLRLVGLSRVLRVVPQTVLNE
AQVTIIVEDASGIDYEKGPTLSFKLLAVEIDTPERFSATADIVINLLDTNDNVPKFTSEY
YIARIPENSAGGSSVATVTANDPDSGPWGEVKYTIYGSGSDLFHIHPSSGLITTQPWTSL
DAEVRSKYNFYIKAEDSEGKYSLAEVFVTVLDMNDHPPAFNEELLEKTMVIGAPVKVEAV
DEDAESPNNVIEYSIMTADPDNAFEINTETGEIMLKPYIKSMEIVQNITKEKDCKWSLVV
QARDRGSPSFSTTAVVNIDITEATPLKGPMAAFLMRSRDNPMKALGMVIGIISMLVGVTV
LISTAIYMRNSKSNRIAPVRRVIKKRPKDQQHWTFRMPIIKFNNPADKFLIDNPEEGLQQ
SSGSPRPKPPPPSAPCLPPPPPSNARVSEWQRAVPTISGALVSRGSKKAKSSRRKEGNIS
SALVSELKMRLEQKIIENNQGYY
Download sequence
Identical sequences H3DQ10
ENSTNIP00000022609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]