SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022610 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022610
Domain Number 1 Region: 472-590
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 127-253
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-21
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 253-357
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.005
Further Details:      
 
Domain Number 4 Region: 582-688
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.00086
Further Details:      
 
Domain Number 5 Region: 43-139
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.0043
Further Details:      
 
Domain Number 6 Region: 359-476
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000114
Family Cadherin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022610   Gene: ENSTNIG00000019404   Transcript: ENSTNIT00000022849
Sequence length 868
Comment pep:known_by_projection chromosome:TETRAODON8:2_random:1370813:1378499:-1 gene:ENSTNIG00000019404 transcript:ENSTNIT00000022849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKEQSPQALLFLLLIHATLDQGQSDYAPYFYDNGASSKNGNMALFSISEDTAVGTQVYV
LNGTDPEGDPVRYGLTFEKGSKEYFRVDSKSGNVSLIQELDREKQDEISVLVSITDGRNK
VVETVRVFVTDANDEAPEFQNPPFIVAVSEDTAAGSSIYRVQAVDRDMGSGGSVSYFLQV
VVIRCQTSPFSKFTIDGHSGILRIKPSETLDYETTPTHFVTVVAKDGGGKYKGRNQVLSS
TATITVNVIDAQDMPPSFIGTPYFGYIYEVSVPGSEIITVSARDGDQGNPNPIFYSILNG
SDGVFDINSTTGCITVTTYPSLLKKELYEIKVKASEIGSNGQLPDYDVTTVTIRVVDLNN
HPPTFYGENGPQDKFEVTMHEHPPAGEILRGFKITVNDSDQGANAKFKLRLVGLSRVLRV
VPQTVLNEAQVTIIVEDASGIDYEKGPTLSFKLLAVEIDTPERFSATADIVINLLDTNDN
VPKFTSEYYIARIPENSAGGSSVATVTANDPDSGPWGEVKYTIYGSGSDLFHIHPSSGLI
TTQPWTSLDAEVRSKYNFYIKAEDSEGKYSLAEVFVTVLDMNDHPPAFNEELLEKTMVIG
APVKVEAVDEDAESPNNVIEYSIMTADPDNAFEINTETGEIMLKPYIKSMEIVQNITKEK
DCKWSLVVQARDRGSPSFSTTAVVNIDITEATPLKGPMAAFLMRSRDNPMKALGMVIGII
SMLVGVTVLISTAIYMRNSKSNRIAPVRRVIKKRPKDQQHWTFRMPIIKFNNPADKFLID
NPEEGLQQSSGSPRPKPPPPSAPCLPPPPPSNARVSEWQRAVPTISGALVSRGSKKAKSS
RRKEGNISSALVSELKMRLEQKIIENNQ
Download sequence
Identical sequences H3DQ11
99883.ENSTNIP00000022610 ENSTNIP00000022610 ENSTNIP00000022610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]