SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022654 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022654
Domain Number 1 Region: 417-810
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-124
Family Ankyrin repeat 0.000000000451
Further Details:      
 
Domain Number 2 Region: 81-435
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.94e-106
Family Ankyrin repeat 0.000000235
Further Details:      
 
Domain Number 3 Region: 1424-1540
Classification Level Classification E-value
Superfamily DEATH domain 4.42e-26
Family DEATH domain, DD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022654   Gene: ENSTNIG00000017033   Transcript: ENSTNIT00000022893
Sequence length 1965
Comment pep:known_by_projection chromosome:TETRAODON8:17:11930271:11965058:-1 gene:ENSTNIG00000017033 transcript:ENSTNIT00000022893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEANVHTARGTRRDRRSGSESDSNASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNA
LHLASKEGHVEVVAELLKLEATVDAATKKGNTALHIASLAGQSEVVKELVNNGANVNAQS
QNGFTPLYMAAQENHLEVVRFLLENGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDT
KGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR
GAAVDFMARNDITPLHVASKRGNSNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVV
EILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLRYDVPVDDVTNDYLTALHVAAHC
GHYKVAKLLLDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPI
HVAAFMGHENIVHALTHHGASPNTTNVRGETALHMAARAGQAEVVRYLLKNGAKVETKSK
DDQTALHISSRLGKVDIVQQLLQCGASANAATTSGYTPLHLAAREGHHDVAVMLLENGAS
LCSSTKKGFSPLHVAAKYGKMEVASLLLQKGAAPDAAGKRLLQSGLTPLHVAAHYDNQRV
ALLLLDQGASPHSAAKNGYTPLHIAAKKNQMDIGTTLLEYGADTNAVTRQGISPIHLAAQ
EGSADLLSLLLAKHANVNVCNKSGLTPLHLAAQEDKISVAEVLLNHGADVNPQTKMGYTP
LHVACHYGNAKMANFLIQNQARINGKTKNGYTPLHQAAQQGHTHMVNLLLQHAASASELT
VNGNTALSIACRLGYISVVDTLRPVTDENLAAMSTSEKHKINVPETMNEFLDVSDDEGDD
AMTGDTDKYLRPQDLKELGDDSLPQEGYMGFSIGARSASPRISSDRSNTLNRSSYARDSM
MIEEILAPTKDTHLAVTRDYSSECMRRYSWTPDTVDHSHNTASSPIHSGFLVSFMVDARG
GSMRGSRHTGMRIIIPPRKCTAPTRITCRLAKRHKLAYPPPMVEGEGLVSRLVEVGPAGA
QFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHQFDMGAEDLPELLAGMDEELDSP
AELEKKRICRIVTTDFPQYFAVVSRIKQDSSHVGPDGGMLSSSTVPMVQASFPQGALTKR
IRVGLQAQPVPDDLVRAILGNRATFSPIVTVEPRRRKFHKPITMTIPVPPRSAEGHPSGQ
RGDCAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTECVSFTTNVSARFWLADCHQIPET
VSLASQLYRELICVPYLAKFVVFAKMNDAVEARLRCFCMTDDKVDKTLEQQENFEEVARS
KDIEVLEGKPIHVDCYGNLSPLTKSGQQLVFNFYSFKENRLPFNVKIRDVGQEPCGRLSF
LKEPKSTKGVPQTAVCNLNITLPTHKRTEKPERRHTFASLALRPQSPCERTDLRLAIVAD
HLGLSWTELAREMNFTVDEINQIRLENPNSLTAQSFMLLKKWVSREGKSATTDALTTVLT
KVNRMDIVTLLEGPIFDYGNVSGTRCFADDGSVFRDQAEDYQNILAELRSPAALRSAPPF
LDPEPCELDADMAASTSSPSLTSLSSITPSSPERPRGPPCVLVGRQEVGGSVESKGAGMV
ATEMEGNVEKWLKPDLIKHVDRKCEMIMKGRCEGGAEESVERELLVEVKEAGRDVEPRDA
QDRREEEGDEELPGGFLLEVVEKGGGTEEKKELRGPSRVRLEQTEKQMLSPVGWHSDSSS
VNVEPPTPGRSVSSDLLDRRESSQENSSDSITSSSRGESGRPPPNGNGSKPSPQEGEGRA
HLREESSGNSGFLTHSNAALRPQLRSSSLGPESTAASAQSCSFCLDAGGELPAAAQALSE
CACLHNLCPRQQRVSLDSGSEEEQTVTTRIFRRRLILKGEEARNLPGESVTEEHYLDRDG
NLVSRKVIRKVIRRVSTPTPEAQRAEGPRNSRRREERRSGDKKVH
Download sequence
Identical sequences H3DQ55
ENSTNIP00000020160 99883.ENSTNIP00000022654 ENSTNIP00000022654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]