SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022679 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022679
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-23
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 273-314
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000011
Family MYND zinc finger 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022679   Gene: ENSTNIG00000019466   Transcript: ENSTNIT00000022918
Sequence length 314
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:97467752:97470509:-1 gene:ENSTNIG00000019466 transcript:ENSTNIT00000022918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDGMTPLMHAAYRGRTEVCRLLLQRGADVNCHQHEYGYTALMFAALSGKTDIASMMLDEG
AETEPVNSVGRTAAQMAAFVGQHDCVTLINNFFSRARLEVFTRPQGQEQEARLPPKLAGP
LHKIIMTTNLNPVKMVLLVKEQPLLVDVAALEKCYRVMDLLCEQCVKQEDMNEVLALKMH
YISCVLQKCLASLRKRDDQLDGLLQMLLRGRERDGFPQNQERFVRDCLRRFPYCEATLLQ
QLLRSAAPLETGDRPTAFSVLTQALTGQVAFVDADYCATCGERGADRKCSLCQSVIYCSS
RCQKLHWSTHQKMC
Download sequence
Identical sequences H3DQ80
ENSTNIP00000022679 99883.ENSTNIP00000022679 ENSTNIP00000022679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]