SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022710 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022710
Domain Number 1 Region: 212-409,437-546
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.27e-55
Family Integrin alpha N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 40-235
Classification Level Classification E-value
Superfamily vWA-like 4.3e-50
Family Integrin A (or I) domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 551-696
Classification Level Classification E-value
Superfamily Integrin domains 2.09e-32
Family Integrin domains 0.001
Further Details:      
 
Domain Number 4 Region: 697-829
Classification Level Classification E-value
Superfamily Integrin domains 1.57e-20
Family Integrin domains 0.0076
Further Details:      
 
Domain Number 5 Region: 853-1032
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000262
Family Integrin domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022710   Gene: ENSTNIG00000019500   Transcript: ENSTNIT00000022949
Sequence length 1067
Comment pep:known_by_projection chromosome:TETRAODON8:8:8301638:8312076:-1 gene:ENSTNIG00000019500 transcript:ENSTNIT00000022949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACAPLWSQECGTSAFSTGICTSVSDNLEPGEAIAPTSQRCSTYMDIVIVLDGSNSIYPWY
EVQNFLSNILSKFHISTDQMQVGILQYGEVALHEWSLKDYQTTQEVVEAAKNISRQEGRE
TRTAYAIHKACTEAFSPERGAREGATKVMIVVTDGESHDGEELPDALQECEDRNITRYAI
AVLGHYIRRQQDPETFISEIKYIASDPDDKYFFNVTDEAALNDIVDALGDRIFTLEGTLG
YNQSSFHMEMSQIGFSTHKLDDGILFGMVGAYDWDGGVLKEGIYGRIAPSREAFESEFPL
ELKNHAAYLGYTVSSVIVGDWKRLYVAGAPRFKHKGKVILFELSDDGDVNIAQALNGEQI
GSYYGSEVCGLDVDQDGITDLLLVAAPMYLGSGNKEAGRVYIYSFTGVRRLWRLFFSSWS
KNPHLFIPCCTSIDEEVFVPNGTLKSEERSQDARFGYALAAAPDLNHDGFTDLVVGAPLE
DEHRGAIYVYHGDGIYVNPNYKQRIPGSSLSPSLRYFGRSVSTQLDLDGDQLIDLAVGAH
GSAVLLSSRSIVQINVSLSFQPHSINVIQKTCQRGGRESSCLNATACFTTVSRSPGPQST
SFDLWVSATLDDRKLSARALFDDSSHRQTQLALQVHTGRTVCHRLPFHVYDTADYIRPIS
FSLKFKINDTESGPVLDEGWPTTIKKSIQFFKDCGEDDVCTTDLVLQAHMDVTGSRQKPY
VIRSPRRRLAVEVQLQNRLENAYNTSLTLHYSKNLHFSSLSIRMECTALGANSHSCNVSY
PVFRSQSKVNFMLEFEFSCTSLHSRVQMKLHAASDSVEREETLMDNSVQLQSFVQYEPDL
FVSDSNLKRYEVHPTRTVSEAIGPEFHTHLRLQNLGCYSVSHLELRLRLPSVAAEDARFM
TLTDVFSYNATGVNCSVQSDLAQLKARQGDVRTLHPEDMMQNDVLNCSRSWCTEVVCEVQ
QLLKGQAVVVRVSRRVHDDFFRKAKYKSVRIIGAYRLAARETNLITLGKETVWRETVLEV
LKGRAIPISLWILIGSVIGGLLLLSLIIFILWKLGFFTRKQRGEEEN
Download sequence
Identical sequences H3DQB1
99883.ENSTNIP00000022710 ENSTNIP00000022710 ENSTNIP00000022720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]