SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022726 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022726
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 2.35e-49
Family ATP-dependent DNA ligase DNA-binding domain 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022726   Gene: ENSTNIG00000019506   Transcript: ENSTNIT00000022966
Sequence length 133
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:43176683:43177479:-1 gene:ENSTNIG00000019506 transcript:ENSTNIT00000022966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVPYLAVARTFQKIEEDSGRLRNIETLSNLFRSVLLLSPDDLLCCVYLCLNQLGPAYQGA
ELGVGETVLMKAVAQATGRQLDKIKAEAQERGDLGLVAESSRSNQRTMFQPASLTAAGVF
RKFKEIASMSGNA
Download sequence
Identical sequences Q4TIX0
99883.ENSTNIP00000022726 ENSTNIP00000022726 ENSTNIP00000022726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]