SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022761 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022761
Domain Number 1 Region: 70-297
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-41
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 319-510
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-26
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 3 Region: 1112-1375
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000284
Family Rhodopsin-like 0.023
Further Details:      
 
Domain Number 4 Region: 10-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000236
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 5 Region: 650-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000795
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 6 Region: 520-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 558-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000531
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022761   Gene: ENSTNIG00000010483   Transcript: ENSTNIT00000023001
Sequence length 1680
Comment pep:known_by_projection chromosome:TETRAODON8:19:5861137:5886589:-1 gene:ENSTNIG00000010483 transcript:ENSTNIT00000023001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFTGDYCETEIDLCYSGPCKNNGRCRSREGGYTCECMDDFTGENCEVNASSGRCIPGVCK
NGGVCVNRLAGGFMCECPPGEYEKPYCEMTTRSFPGQSFITFRGLRQRFHFTVSFMFATR
ERNALLLYNGRFNQKHDFIAVEIIDEQIQLTFSGGETRTTVSPYVPGGVSDGQWHSIQLH
YYNKPNMGRLGIPHGPSGEKVAVVAVDDCDISMAVRFGKQIGNYSCAAQGTQTGQKKSLD
LTGPLLLGGVPNLPEDFPVSNRDFVGCMKKLSIDSKPIDMDSHIANNGTTPGCSAKKNFC
VKQVCHNGGVCVSKWNTYICDCPTGYGGKNCEQVMPSPQFFNGQALVSWSDPDITVAVPW
YMGLMFRTRQPAGTLMQANAGLSSTINLMVSEQQLRMEVMSRHQLVATLGFPQVRVDDGE
WHHLLVELRSVKEGKDIKYMAAVSLDYDMYQKSVEIGYDLPGLKLQTLYVGGLPAADNHV
SKGFVGCIQGVRMGETSTNVANVNMAQGLKIRVKDGCDVADPCDSNTCPENSHCSDDWST
HTCVCDPGYFGKECTDACQLNPCEHVSTCVRKPSSSHGYTCECGQNYYGQYCENKVEKPC
PHGWWGSPMCGPCSCDTSRGFHKDCNKTSGECRCKDNHYRPEGEDVCYPCECFSLGSESR
TCDAVTGQCPCKGGVIGRQCNRCDNPFAEVTSTGCEDTVVYEGCPKAFDAGIWWPKTRFG
RPAATQCPKGSVGTAIRHCSDEKGWLQADLFNCTTVTFTHLKKMNDELRRNISRMDSEHS
KAAVRLLHSATTNMPHYFGNDVRTAAELLNHVLQYESQQAGFELTAMKDSEFNENLVRAG
SSLLDPSNKEHWDQIQRTEGGTAHLLRNFEDYANTLAQNVRKTYLKPFTIVTDNMILTVD
YLDVTDPEKATLPRFEEISEVYPKELGSYVQFPQFDLRPQGHKAHPAEPLPTPPTQTDSL
QEEVTTVSDRRRRHLEPAAPLPVAVVIVYKSLGKLLPERYDSDRRSLRLPNRPVINTAIV
STTVHSEGPPLPPVLDPPITLEYTLLETEERTKPVCVFWNHSLAVGGTGGWSSKGCELLN
RNNSHISCQCNHMTSFAVLMDISKREHGDVLPLKIVTYTTVSVSLFLLLITLILLCLLRR
LRSNLHAIHRNLVAALFFSELVFLLGINQTDNVFVCTVIAILLHYFYMCTFAWMFVEGLH
IYRMLTEMRNINHGHIRFYYAIGWGIPAIITGLAVGLDPQGYGNPDFCWLSVHDTLIWSF
AGPIFVVVLVNIVIFVLSAKASCSRRQKAMEKSGAIPALRMAFLLLLVIGATWLLGLMAV
NSNVMLFHYLFAVCSCLQGIFIFFFHVIFNKDVRKNLKNVFTGKKMVSDESSTTRASLLT
RTLNSNNAYEDGTIYRSGIGESTVSLDSTLREESGQKSKVSTATAKGHMDLDGPLFQRNS
TKGRWFSDDSDSDSELSVDEHSSSYASSQSSDSEDDDIDAKPKWNNERHPVHSTPKVVDS
VSNHVKPYWPAEATTASDSEDLGGAERLRVETKVNVELHQENKLNHTGERERETQPEREK
PASGRDTAPPNQQNSHSNHQPEQRKGILKNKINYPPPLSDKNMKNRLREKLSDYNSPTIT
SPPPNNNTSSSHPPSSVNIIWIPPVAIYRETNGGMAMHLKSGTVNGGNESDSDGSNETSI
Download sequence
Identical sequences H3DQG2
ENSTNIP00000022761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]