SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022778 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022778
Domain Number 1 Region: 15-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-36
Family Pentraxin (pentaxin) 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022778   Gene: ENSTNIG00000019549   Transcript: ENSTNIT00000023019
Sequence length 221
Comment pep:novel chromosome:TETRAODON8:Un_random:100490218:100491172:-1 gene:ENSTNIG00000019549 transcript:ENSTNIT00000023019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLLHFFFSLFSFVDLSGKMFVFPKETNTAHVKLTPSREDFSKVTVCHRSFTDLKRDHILF
SMATPSNANGLLVFWDEANKELEPHIKDKKSEYRGLDYKPNTWHSVCTTWDSESGMVQLW
FDGQFLMKKFSTSGSNIRGTTIIILGQEQDSHGGGFDLKQSFVGMMSDIHMWDYVLSPCE
IHNYMDDLNYTPGNVLNWRALEFQIRDMVLTEDKIKSCQVS
Download sequence
Identical sequences H3DQH9
ENSTNIP00000022778 99883.ENSTNIP00000022778 ENSTNIP00000022778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]