SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022806 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022806
Domain Number 1 Region: 74-300
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.81e-81
Family Fibrinogen C-terminal domain-like 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022806   Gene: ENSTNIG00000019573   Transcript: ENSTNIT00000023047
Sequence length 308
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:97294001:97296459:-1 gene:ENSTNIG00000019573 transcript:ENSTNIT00000023047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNMYSDLASTMAVMKKEDVKVPPTCEQQVEPLKAEIQALNKVISDQQHYIQELHRNHGRH
LEQIPSAPLGAGSAHRDCSDVFADGNVASGVYVIRPDGSPTALSVYCDMNNGGGWTVFQR
RRDGKENFDSRAWVEYKHGFGDMFSPEGEFWLGNEPLHHLTLQGNYELRIDMEDFDGNQR
YAEYKNFLVDDEEDEYQLHLGEYTGNAGNALVNTQMSPPEEEAWSVPGIKFSTYDHLNDS
DSRCVRHSRSGWWFSRCDSGNLNGHYYNGPYQAMTDDGVVWYTWHGWWYSIKSVVMMVRA
DDLQHPAE
Download sequence
Identical sequences H3DQK7
99883.ENSTNIP00000022806 ENSTNIP00000022806 ENSTNIP00000022806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]