SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022840 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022840
Domain Number 1 Region: 30-414
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.8e-96
Family Ankyrin repeat 0.00000822
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022840
Domain Number - Region: 1081-1144
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00157
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022840   Gene: ENSTNIG00000002502   Transcript: ENSTNIT00000023081
Sequence length 1560
Comment pep:known_by_projection chromosome:TETRAODON8:14:10114487:10123241:-1 gene:ENSTNIG00000002502 transcript:ENSTNIT00000023081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTTSIKMTTLAIQNLFGYVEEENLAALKAHLDRFKEVDGRSDNGQTPLMLAAEQGSLEIL
QELIRRGANVNLDDVDCWSALISAAKEGHVDVVKELLENSAYIEHRDMGGWTALMWAAYK
GRVEVTELLLQHGANTNTTGQYSVYPIIWAAGRGHAEIVKLLLQNGAKVNCSDKYGTTPL
IWASRKGHFDCVMHLLEAGADVDQEGANSMTALIVAVRGGYAAVVKELLKRKPNVNMTDK
DGNTALMIAAKEGHTQIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYAD
IDIKGQENKTALYWAVEKGNATMVRDILQCNPDTETCTKDGESPLIKATKMRNVEIVEML
LDKGAKVSAVDKKGDTPLHIAIRGRSRRLAELLLRNPKDGRLLYRPNKGGETPYNIDCSH
QKSILTQIFGARHLSPTETDGDVLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSF
LLKKLEGGVPARKNTHTHARATHTLPLSQAHGHTLLCVCCPREEEKQTCCVPSFLLCLLV
LACLFAGLALMAVVHVDGQNRTANGVLVAMGGVVAVALLLNVKTCWRLVDSVVNSQRKRL
HGAANRLHKLKSEAFINVLNHQVELMAKMAKTIDFTHHQTRLAVVIDGLDACEQDKVLHM
LDTVRVLFSKGPFISIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSR
GLSSARKVAAAPSTNGDAANADGNRWQEEPDRKLSQHSLSELSRTAPGRRDTYRRRQAQR
SVTRQVSVDLSKLMVTEDWFSDISPQTMRRLLNIISLTGRLLRANQITFNWDRLASWINL
TEQWPYRTSWLILYLEDTQGVPDHAALKTLYERVSKNIPTTKDMEPLLEIDGDVRSFEVF
LSSRTPVLTAKDIRTFLPCTVNLDPKLREVIADVLAAREQMNVGGVNYPPLPLQEVQPRP
ASVYSQVSSACSPSASFSGAFHQPAGGVASPQPHSSYYSGLSGAQHPFYNRGPFFPHHLC
QLPRPLVGSTHPSLHPHQPKCQGSSLKKTQVFTRRLKQPTPSPSPASVVSAASAVFLGSM
TTEAICELLRQIDGIDASMLGQYSATVRKANVNGRVLSQCNIDELKKEMSMNFGDWQLFR
ATVLNMRHMENQLLQEDAASEQGSVVGGGGEAGRRGGAPPPANADGSAMFTFNLSFEELS
TLGLEEPARAGGVAWMSAAQRTASMNSLNSQESSNDIGKLTDRQQAEYRSAYQEYIAQMA
QLEMGGGGGERPVQPQPGQFMTPPEDKSKDGGEQDGRKAFGKRNGGKAAPDNPDFCSGDL
LDPITEEDEHGAARTPRARRSSAERGGLFQGAADLKLKAGGGLRYQKLTSDEHEWEESDS
KAAARAPGGGAVLKAKDFLSESTLDKKESSDSGVRSSESSPNHSLQDEEAELSQLERSPL
MELQEPAVVRMSICSEDQCSLLASSPEESWPSSGTFNLNRSPSNVTLNNNSHAQHATAAS
SHRVGPSRSSTPSAGTRPGPNNENVRVVHLKRAVTPGDPPEICTMSCDTVTFSEERESIL
Download sequence
Identical sequences H3DQP1
ENSTNIP00000022840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]