SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022848 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022848
Domain Number 1 Region: 157-270
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-23
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 2 Region: 19-142
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.83e-21
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 3 Region: 300-480
Classification Level Classification E-value
Superfamily vWA-like 3.95e-17
Family Integrin A (or I) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022848   Gene: ENSTNIG00000015121   Transcript: ENSTNIT00000023089
Sequence length 556
Comment pep:known_by_projection chromosome:TETRAODON8:9:3120304:3156242:-1 gene:ENSTNIG00000015121 transcript:ENSTNIT00000023089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLMGSFKEAQSTTRFRCFLLLSCRNLLDRDTFSKSDPLVVLYTQGVECKQWREFGRTEV
IDNTLNPDFVRKFILDYFFEEKQNLRFDVYDIDSKSPDLAKHDFLGQVHCTLGEIVGSPA
SRLEKSLGGIPGKKCGTIVLSAEELIICRQDCATMQFCANKLDKKDFFGKSDPFMVFYRS
NEDGTFTICHKTEVVKNTLNPVWQAFSIPVRALCNGDYERTIKAEIYDWDRDGSHDFIGE
FTTSYKELCRGQGQSNVYEVMNAKKKLKKKRYINSGTVSLLSFSVESEHTFLDYIKGGTQ
IHFTVAIDFTASNGNPSQSTSLHYMNPYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGA
KLPPDGRVSHEFPLNGNTENPYCNGMEGILEAYHQSLKTVQLYGPTNFSPVVNHVARYAA
AVQDGSQYFVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDI
RISSRGKMAERDIVQFVPFRDYMDRTGNHVLSMARLAKDVLAEIPDQLISYMKSRAIKPS
PVPPAYSTGTQPPSNP
Download sequence
Identical sequences H3DQP9
ENSTNIP00000022848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]