SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022850 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022850
Domain Number 1 Region: 66-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-19
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022850   Gene: ENSTNIG00000019612   Transcript: ENSTNIT00000023091
Sequence length 133
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:100403959:100405333:1 gene:ENSTNIG00000019612 transcript:ENSTNIT00000023091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPFGMGMPGIRAGYPLSERQQVALLMQMTAEESINSPDTTPKHQSQSSLGQKGTPNSA
SKTKDKVNKRNERGETRLHRAAIRGEVRRIKELISEGADVNVKDFAGWTALHEACNRGYY
DVAKQLLAAGAEV
Download sequence
Identical sequences H3DQQ1
ENSTNIP00000022850 99883.ENSTNIP00000022850 ENSTNIP00000022850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]