SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022868 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022868
Domain Number 1 Region: 231-363
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-34
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 445-570
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 344-449
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-24
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-19
Family Cadherin 0.0092
Further Details:      
 
Domain Number 5 Region: 561-669
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-17
Family Cadherin 0.0061
Further Details:      
 
Domain Number 6 Region: 30-105
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000971
Family Cadherin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022868   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000023109
Sequence length 938
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:101552:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000023109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQRRGKPWTVRGCSLGCLVVVVLWSAASAQIRYSISEEVNEGTAVGNVAKDLGLDRNTL
KERKCRIVSSTADVLFQVDQNDGVLYVSRKIDREEVCAQSSSCLMNLKTVLENPLEIHYV
EVEVLDVNDHSPRFPEEKKILDISENVLPGARFQLKGAQDADSGRFSVQQYKLSQNDHFR
LEVKDRGKDGKIPILVVQKSLDRETAGSHSLVLTALDGGKPPKSGEMNILVKVLDVNDNT
PVFSKDAYSVMLPENAPLGSAVVQVNATDLDEGQNGEVYYSFGNSVSNNLFQLFDINSLT
GEITVRGPIDYEQKDKYEIEIEASDKGLPPLKTEKSVIIKIIDVNDNTPEIEVTSLSTSI
PEDSRTGTTVALISVSDLDSGLNGRVVCSMAENVPFMLAPSLQDKMYSLVTKSPLDREQT
GTYDLTITAKDAGRPSLSSERTITVVVSDVNDNSPEFSLSPYTFYISEANQPGTSVFAVK
AFDRDENDNARVSYHILRDGSPENKLTSFLNINSETGDILALKSFDFETLKTFQFQVVAS
DSGSPSLSSNVTVKVFILDQNDNAPVILYPVSSNGSAEGLEEIPRNVNAGHLVTKVRAYD
ADIGYNGWLLFALQEVSDHSLFGLDRYTGQIRTLRSFTETDEAEHKLVILVKDNGNVSLS
ATATVLVKLVEPKEAFAASDVQSSAQDDEDGHVTFYLMITLGSVSVLFIISIIVLIAMQC
SKSPDYTSKYVPETNYDGTLCHSIQYRSGDKRYMLVGPRMSIGSTIVPGSHANTLVLPDR
RRTNEEPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGVLVQNWPTASSAADAEG
GEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFIIPGSPAIISIRQNQGGE
DDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3DQR9
ENSTNIP00000022868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]