SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022877 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022877
Domain Number 1 Region: 125-228
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-24
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 224-276
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000141
Family Cadherin 0.0025
Further Details:      
 
Domain Number 3 Region: 29-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022877   Gene: ENSTNIG00000019634   Transcript: ENSTNIT00000023118
Sequence length 282
Comment pep:novel chromosome:TETRAODON8:Un_random:44079506:44080351:1 gene:ENSTNIG00000019634 transcript:ENSTNIT00000023118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLAMVLEMVSARTCVFCVLIWLHAACGDLSYSVPEEMKAGSVVGNLATDLGMETGSLARR
RARIDTEGGNKRYCDINLKNGELVVAHRIDREGLCGEKATCVLKHELVLENPLELHRVSL
HIQDINDNSPQFNEGSINLEIQESADRGARYVIEEAHDADIGQNSVQQYSLQKNNHFILA
ANGNTVELVLDKELDREKQSEINLLLTALDGGSPQRSGTVVIHVTVLDANDNAPVFSQAV
YKASLPENSPLDTLVITVRAADADEGVNGDVTYDFGHVSDHV
Download sequence
Identical sequences H3DQS8
ENSTNIP00000022877 ENSTNIP00000022877 99883.ENSTNIP00000022877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]