SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022887 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022887
Domain Number 1 Region: 21-171
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-29
Family C-type lectin domain 0.00000888
Further Details:      
 
Domain Number 2 Region: 303-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 240-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 186-251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 425-492
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000132
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 364-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 488-553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022887   Gene: ENSTNIG00000019644   Transcript: ENSTNIT00000023128
Sequence length 553
Comment pep:known_by_projection chromosome:TETRAODON8:1:14746637:14757505:-1 gene:ENSTNIG00000019644 transcript:ENSTNIT00000023128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDYFLLLLSSVLCMRTSVECWSYHYSNTTMDWTQARAWCQEHYTDLVAIQNKEEIEHLNN
WLPERKGYYWIGIRKINNIWTWVGTNKVLTEEATNWAENEPNNGREGKRQKSRQEDCVEI
YIKRSKEPGKWNDESCSKTKTALCYTASCLQNSCSAHAECVETVGNYTCQCHPGFQGPLC
EEAIACQPLLDPEQGSIICSPPDAPYSYNSTCEVRCDEGYEASGQNHLQCDHTGQWSASV
PACTVKKCPPILFPFPGNLTCVDTLEPFSFGSWCSFTCQKGHTLVGEATMTCQASGEWSS
STPRCAVVQCNRLKAPHNAIISCENPLGEHSYGSTCTVECNKGFDLIGTNTTKCSSQGQW
SPQLPVCQARKCHPVDLPRGFLSCFNPNGPFTFGSLCTATCERGFALNGTVSIECSSLGL
WSADIPQCSAKQCPALGSPAHGSLVCSAPHGEFSFGAQCGSTCEDGFLLNGTAETECTSQ
GVWSTETPHCLALQCEAIRVFSSSLYVNCSHPVEELSFGSQCFFSCKEGFSLNGTQTLTC
TSAVFWSDTPPTC
Download sequence
Identical sequences H3DQT8
ENSTNIP00000022887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]