SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022898 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022898
Domain Number 1 Region: 267-434
Classification Level Classification E-value
Superfamily Fibronectin type III 3.12e-16
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 2 Region: 90-168
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000227
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 178-257
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000282
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 4 Region: 7-86
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000249
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 5 Region: 444-518
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000584
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022898   Gene: ENSTNIG00000019655   Transcript: ENSTNIT00000023140
Sequence length 519
Comment pep:novel chromosome:TETRAODON8:Un_random:103146772:103148907:-1 gene:ENSTNIG00000019655 transcript:ENSTNIT00000023140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWNSSKVQNPTVTHSARDDYLKVYWRHAAGDLDVYQVFIKHNNAFLQNKTVPKTQHECE
FTDLVPGRLYIVLVSTWSGHYETSAYTYGRTLPAPVRSLVLTGWATEELRVAWSAAPGDV
DHYEVQLLFSDIKVFPSITLGSGVDECVLSSLTPGRRYKILVSTFSGPNQRARFIEGRTV
PSKVKNIHVSNGGDSTSLKVSWTPGQGDVDAFLVFLFRQTRQQDVRRVLKHQNEVLFGSL
RPGEMYGVTVQSVSGELLNNSTASGRTVPSAVTGLQVEDLHSTHSLQVSWKDALGVADGY
VLQLLDERGGLVANGSLAFGETRHRFEALTAGRRYQVQVQTTSGGVHSQRVNTEARTCPA
AVSDLSVRTNSTNSLSFHWAPPEGDFDRYELFLYRRDDSLQERRRVQPSSQQFSFQGLTP
GAPYRMVVVTHSGEQSNQTSVWARTVPAAVVSLRASAMNQSDRLRVSWDRGPGDLSGYLL
SLYDLNGSRRARTQLGPEAKELVLSDLVPGRLYRAEVLS
Download sequence
Identical sequences H3DQU9
99883.ENSTNIP00000022898 ENSTNIP00000022898 ENSTNIP00000022898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]