SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022908 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022908
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-54
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 526-632
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000018
Family Myosin rod fragments 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022908
Domain Number - Region: 398-484
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.00144
Family Sec2 N-terminal region 0.0078
Further Details:      
 
Domain Number - Region: 986-1151
Classification Level Classification E-value
Superfamily Tropomyosin 0.00549
Family Tropomyosin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022908   Gene: ENSTNIG00000009552   Transcript: ENSTNIT00000023150
Sequence length 1191
Comment pep:known_by_projection chromosome:TETRAODON8:5:10400413:10411897:1 gene:ENSTNIG00000009552 transcript:ENSTNIT00000023150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVERGEVDKVAAVLSKKGVVPTKLDVEGRSAFHLAATRGHLDCLNLILAHNVDVTATD
ASGKNALHLSSRNGHSQCVQKLLQHNCPVGNVDLQGRIALHDAVMAGCSSSVKLLCDSGA
AVNATDFDGRTPLVLATQMCHPRICQLLLERGADITIRDKQNKTALILGCEYGCKDAVEV
LLKSGADVKAVDSLGHDAFHYARLSKNTELVALVKTHLDKITRDKETAKMEQWKHQQSVE
RFESLESNRRDQIIHDLERQNETLQESLKKYHQEQRALIDKVNLLQQQLTQEKLTVEGAQ
KEKEQLKGLLVAKDGEEGARGSETVKVQLRSTLGDYSGQSVIKGKENVLVKQAHSLDSDH
VSLTHFYPNFEQIVQKLSVSRPGDKSQPTVGWDVSGELNTLRQEHEAVKRKQHAAEEEVA
RLQSALNRKNRECQELVQSRDAIQKQADQQIHELEEALGDVQKRMLDSECKVKQLQAHVV
AVKEHLGGQGVEDLRLQLQDVKAKYEGASAEEQLNEFRTRIEMDFIPIRDYEEARKSMVM
ALEELEDKLVEASERYGKAEAQVQQLQAERTQLQENISSIQSSSKTHQSQLDELSSHNCD
LLKKIELMQRQSEDGKKERVQLNARIQTLEKSLAAEYVPRQQHENVKAELGSALESARAE
TLQTQKEKKASEEELTKVKDGNDRLKEELEKLSQEMKDDRIHVKEHKDATEKLKATVAEA
ETKVKEVTALYLSAQEETVKLTQELEAQKKELDTIQQAIQSKFISVAAAEEKQKAHLVQV
ADLQNKLAEMEAEYTKEKCAGQSNKQEQEKLKVEMESVQQRLDSALVTSERHRDVEEEFK
SRCDQLTHKLSSLEQQHQELLLQKADLHEQNALCRTQNQNLQDRLKAELTRIATYDSELK
ALHDAMQQAQTDCKKAREARQEEAQKVGALQKELQEQRRDQASLLQQQAQSEERLEAEMA
EISRLRLALREEEENSAQRAEDVSALQSELLQATQALEKVRYKEEQMNQMKKEKQELEKE
VTDLSSKLLGVADQCKEAQQEAARAREKESKEKGNTIEGEIGELKKRYDESLSTIGDLQR
RIQTSAQQTEAKDKKITELLTDVERLKQALSGLSQLAYTSNTPSKRQAQHTDAMQAQIRS
LQQQLADAERQHREVVSIYRTHLLSAAQGHMDEDVQAALLQIIRMRQELVC
Download sequence
Identical sequences H3DQV9
ENSTNIP00000022908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]