SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022948 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022948
Domain Number 1 Region: 87-170
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-30
Family Kringle modules 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022948   Gene: ENSTNIG00000019703   Transcript: ENSTNIT00000023190
Sequence length 170
Comment pep:novel chromosome:TETRAODON8:Un_random:105987822:105988425:1 gene:ENSTNIG00000019703 transcript:ENSTNIT00000023190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQFSQFAVRSLCFHVFPLCDEAQLCRDECQALEQDLCSLEYTLARSDPRMLMQLELPR
CHLLPQPGTPGAASCMRIGVPPERLSPYSPAEQSCFNGSGADYRGTLSRTRSGQRCQAWS
AQHPHSHHLPQEHPQLWHSHNFCRNPGGQMEAPWCFTLDPQVRYDLCDLP
Download sequence
Identical sequences H3DQZ9
ENSTNIP00000022948 ENSTNIP00000022948 99883.ENSTNIP00000022948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]