SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022949 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022949
Domain Number 1 Region: 73-181
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-28
Family Ras-binding domain, RBD 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022949   Gene: ENSTNIG00000019704   Transcript: ENSTNIT00000023191
Sequence length 196
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:103176504:103177383:1 gene:ENSTNIG00000019704 transcript:ENSTNIT00000023191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYGSSSGASMSLPSKNRMKRQSKTFTQVLYRTLSYRDRVPVEAGTNTRGDRRSTTEPPE
RPADDPAELSTQSSAPGVLKIFGDEICAGANYKSVLATPRSSAHELVKEALERYSLNKNT
AHSYVLCDVIGRLEGEGDVGGGGWRTECLRALGDNEKPLLLQELWKPREGYARRFELRRR
AEVEEINAKEKDTVTA
Download sequence
Identical sequences H3DR00
99883.ENSTNIP00000022949 ENSTNIP00000022949 ENSTNIP00000022949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]