SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022950 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022950
Domain Number 1 Region: 9-165
Classification Level Classification E-value
Superfamily E set domains 3.5e-53
Family RhoGDI-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022950   Gene: ENSTNIG00000019705   Transcript: ENSTNIT00000023192
Sequence length 169
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:101047765:101049211:1 gene:ENSTNIG00000019705 transcript:ENSTNIT00000023192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLPFQTTSASPEDNVHMIDFTRFKIRDMETGTVLFEITKPPTPAGDKKQSDPNAGRFVR
YQFTPFLQLRQVGATVEFTVGDTPINNFRMIERHYFRDQLLKSFDFEFGFCMPSSKNTCE
HIYEFPALSEEIMHEMILHPYETQSDSFYFVDNKLVMHNKADYSYSGGP
Download sequence
Identical sequences H3DR01
ENSTNIP00000022950 99883.ENSTNIP00000022950 ENSTNIP00000022950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]