SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022973 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022973
Domain Number 1 Region: 470-596
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.76e-31
Family Synaptotagmin-like (S variant) 0.00000319
Further Details:      
 
Domain Number 2 Region: 1099-1221
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.4e-23
Family Synaptotagmin-like (S variant) 0.0033
Further Details:      
 
Domain Number 3 Region: 299-430
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-19
Family PDZ domain 0.0000752
Further Details:      
 
Domain Number 4 Region: 19-101
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.44e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022973   Gene: ENSTNIG00000014154   Transcript: ENSTNIT00000023215
Sequence length 1254
Comment pep:known_by_projection chromosome:TETRAODON8:18:1333280:1357441:-1 gene:ENSTNIG00000014154 transcript:ENSTNIT00000023215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHQQFESYKQEVRRIGAETRRQQTQQKDDAPTCGICHKTKFANGCGHLCSYCQTKFCARC
GGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGEWFPGSGRGSQGTSLNNLTTGGEAQPD
RKLQRPRSQAPPSINANAGLPDGTQRSTGVVAKGANNMPGSRSQSEPPREKKRPVSLHEQ
NGRCGLGRGSGRRAPGKLQSQSSLDEQIVSGERERHMGVGRRLEKIRSQDFEDGQVNLGP
PETHRRRPEDEEQRDSSEEEGGSTPEYTSCEDVDMESVSEKGDWDYHCLDPAVWHSRSHH
FLLPMSLQHPVSWQPSKEGDHLIGRITLSKRSAMPREAGSLLGLKVVGGKMTEAGRLGAF
ITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGATKKEVYNIILESKPEPQVELVVSRPIG
DIPRIPESTHPPLESTGSSSFESQKMDRPSISVMSPTSPGALRDLPLLLPGQLSVKLWYD
KVGHQLIVNVLQAIDLPPRPDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKSAEPKWNQTF
IYSHVHRRDFRERMLEITVWDQPRAQEEESEFLGEILIELETALLDDIPHWYKLQTHDVS
SIPLPQPSPYLPRRHIHKDSPSKKLQRSHRIIDTEFDDGLITSPQLSCTERNSRERDRGS
TLAVPEQKRPIQHRSRSVSPHREDCCMARSRPAHVPMQRSLDEIHQNRHHSNSPSHYHDP
HLEHQRSGDSDYEYPEDSEVLEMHRSIRGGSAECLHTNRPSDLQPSLDRVRSASTTCLRP
EPNFHFLDRDSYQSKQSRTNFLKQAIKTAWKEMAHLHGGPSPAGTPPSGRRGRQLPQLPA
KSSSIEQALAVEERARQLEMKVHSCRPSVSRNHEIDLKTKREMYAEQRRSSDNMSARSSD
SDRSDVSALSRASSASRLSSTSYMSIQSERPRGRLRSLIPDLMCRHLRSVGRSMLKSSSV
SGEIYSQERTDGSQSDTALGTVCGGSKKRRSSLSARVVAIVGNRRSRSTSQISGPEGKSK
KEKGAPIQRSTETGMAVELTRNMSRQPSRESNNGSINSYSSEGNLIFSGVNLGASSQFSD
FLDGLGPAQLVGRQTLATPAIGDIQISMVEKKGQLEVEVIRARGLVQKPGSKSLPATYVK
VYLLNNGAYVAKKKTKIARKTLDPLYQQALLFEESPHGKVLQVIVWGDYGRMDHKSFMGV
AQILLEELNLSRIVIGWYKLFPPSSLVDPTLASLTRRASQSSLDSSSGPVGVRS
Download sequence
Identical sequences H3DR24
ENSTNIP00000022973 99883.ENSTNIP00000022973 ENSTNIP00000017164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]