SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000023000 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000023000
Domain Number 1 Region: 104-138
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000108
Family HIT zinc finger 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000023000   Gene: ENSTNIG00000019748   Transcript: ENSTNIT00000023242
Sequence length 145
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:48129428:48130486:-1 gene:ENSTNIG00000019748 transcript:ENSTNIT00000023242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAGQHRVLDEATRQRRLSRQLEALEKDNFRDDPLSSLPPPGPTARLPAFSETEEPEKKKR
KTRGDHFKQRFRKNFTALLEEETCRSALSPTTCRPWAPPSSLPPRHFCCVCGFPSHYTCP
TCGGRYCSSRCLCTHRETRCLKWTL
Download sequence
Identical sequences H3DR51
ENSTNIP00000023000 99883.ENSTNIP00000023000 ENSTNIP00000023000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]