SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000023105 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000023105
Domain Number - Region: 52-103
Classification Level Classification E-value
Superfamily Cadherin-like 0.00204
Family Dystroglycan, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000023105   Gene: ENSTNIG00000019836   Transcript: ENSTNIT00000023347
Sequence length 108
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:106318923:106319784:-1 gene:ENSTNIG00000019836 transcript:ENSTNIT00000023347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAPVQLFISLVVVTILSRSHAERNVYPSAGVLFVHVLEREYFKGEFPPYPKSGDASNDPI
TFSTNLMGYPDRPGWLRYIQRTPHGDGVLYGSPMAEHVGKPTVIEVGA
Download sequence
Identical sequences H3DRF5
ENSTNIP00000023105 ENSTNIP00000023105 99883.ENSTNIP00000023105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]