SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000245 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000000245
Domain Number - Region: 6-148
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0722
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000245   Gene: ENSTNIG00000015135   Transcript: ENSTNIT00000000608
Sequence length 347
Comment pep:known_by_projection chromosome:TETRAODON8:9:2966735:2969589:1 gene:ENSTNIG00000015135 transcript:ENSTNIT00000000608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQYTTATTTTGEQIVVQTANGQIQQQAQGTVTAVQLQTEAPVVTASGQQVQTLQVVVQG
QPLMVQVSGGQLITSSGQPIMVQAMSGSQGQTIMQVPVSGAQGLQQQIQLVQPGQIQLQG
GQTLQLQGQQGQPQQIIIQQPQTAITAGQNQVGQQISVQGQQVAQTADGQTIVYQPVNAD
GTVLQQGMITIPAASLAGAQIVQAGGTSTNTTNSNQGTVTVTLPVSGNMVNAGGMVMMVP
GGGAVPTMQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHE
SRHRHAMQRKRGDGGRFYSPKEKEEALLLAQDSNQADETVAHMIRVS
Download sequence
Identical sequences H3BW83
ENSTNIP00000018189 99883.ENSTNIP00000000245 ENSTNIP00000000245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]