SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000401 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000401
Domain Number 1 Region: 192-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-53
Family DBL homology domain (DH-domain) 0.000000366
Further Details:      
 
Domain Number 2 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-32
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 2-216
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.58e-29
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 4 Region: 641-771
Classification Level Classification E-value
Superfamily SH2 domain 1.22e-27
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 5 Region: 790-850
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-21
Family SH3-domain 0.00074
Further Details:      
 
Domain Number 6 Region: 599-665
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000101
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000401   Gene: ENSTNIG00000018966   Transcript: ENSTNIT00000002140
Sequence length 852
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:10723004:10760969:-1 gene:ENSTNIG00000018966 transcript:ENSTNIT00000002140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWKQCSLWLINCKVLPPNHRVTWESAQVFDLAQTLRDGVLLCHLLNNLRPQTINLKEI
NLRPQMSQLLCKWNLGGLLSSPCIFGCRRSFFNEAICRFSCAETGKVVDTLSKLSHTGIA
QQTGIRPFPSEESVEDEDIYNHLEDLIDEKLVEDEEDLYDCVYDDEDGGEIYEDLMKTEA
LPPPPFHKQAEIDIRSCCLTEIKQTEEKYTETLESIEKHFMFPLTSYLSAAEIESVFVNI
PDLVKVHKCLLLDIQESLHHRSAQNLYQIFLNFKERLLIYGKYCSHVETAIGTLDQLCKD
REDIRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLRLAL
DAMKDLAQYVNEVKRDNETLREIDQYQKSIENLNQALSKYGRPKGDGEVRVASVDKRAKQ
DRHIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKETRKWSYGFYLTHKQGQS
GFEFFFKTKELKKKWLEQFGMAMSSNILPENASNNFHDFHMHTFERITSCNSCHMLLRGV
FNQGYLCSRCGLGAHKECLGRFGCCGKTGCGSSAKQSEPRSDTSSRRLTNEGVGKGRDPG
LPKMLVIRSYFGAPSPASGPALNIQAGDIIELLCADIHSAWWQGRILSTKEVGFFPSDAV
KPCPCVPKPVDYSGQPWFAGPMERLQAEAELINRVNSTYLVRHRSREYTEYAISIKYNND
VKHIKILTKEGCFYIAENKKFRSISELIEYYKHHSLREGFRSLDTTLHFPYRELENAAMQ
RLNRPGSNMLTPKVIGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVHGRV
GWFPSTYVEEGE
Download sequence
Identical sequences H3BWN8
ENSTNIP00000000401 ENSTNIP00000022153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]