SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000617 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000617
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 64-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000041
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000617
Domain Number - Region: 18-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00742
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000617   Gene: ENSTNIG00000010500   Transcript: ENSTNIT00000001099
Sequence length 737
Comment pep:known_by_projection chromosome:TETRAODON8:1:17245754:17252635:-1 gene:ENSTNIG00000010500 transcript:ENSTNIT00000001099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STKQLWVVYVRTMAHRLSKRSCKSDSCHQLATCEAQNESKAGCYCKHGYTGDGTTFCDDP
DDNECQNVTNICGERGNCTNTEGSYYCTCLPGYESTGNSSFQPNDGTECIDIDECQWAKE
RCGLNSHCHNTYGSFYCTCQRDYIPTSGTRHFHSGKVVKCKENPQKYCHHSIECITETIN
QTLENMRNFTEPQDLLKEIVKQTSGELSAVEVITYVEALSRSTSILVSTEKDASMEPSSI
NFTLTKLVNAANNLVEKDELAAWNRMKEEHRERTITKLLHTVEESALTLAKNYKIPTELQ
IKAPDMEMKLYTIDAGQTKARVSASMAGDHINLSPKLQAAKDRNGSVSVVFVHYDSVGAI
LEPSSSQGVAGTGEITVNSRVVAAAVRPADIYQLDHVTFTLRHNQEISDIEGDAIKCAFW
EYEPERLQGRWSTRGCRTLHVSSNATTCSCDHLTHFAILMSSGQANLGAHALVLTRITQL
GMIISLICLSMCIFTFWFFREIQSTRTTIHKNLCCSLFMAEFIFLVGINMTAHKLFCSVI
AGLLHYFFLAVFAWMCIEGIHLYLIVVGVIYNKGFLHRNFYIFGYGSPAVVVTISATLGS
KYYGTDKVCWLSTENHFVWSFIGPACLITLVNLLSFGVIIFKVYRHTAVKKPETSHYENI
RSCARGAIALFFVLGVTWTFGVLHILHETTLTAYLFTISNTFQGMFLFIFLCVLSRKIQE
EYYRLFKNVPCCFECLR
Download sequence
Identical sequences H3BXA4
ENSTNIP00000000617 ENSTNIP00000000774 99883.ENSTNIP00000000617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]