SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000738 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000738
Domain Number 1 Region: 93-314
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.57e-17
Family Hypothetical protein TM0207 0.064
Further Details:      
 
Domain Number 2 Region: 15-120
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000616
Family Ring hydroxylating alpha subunit ISP domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000738   Gene: ENSTNIG00000003792   Transcript: ENSTNIT00000002666
Sequence length 588
Comment pep:known_by_projection chromosome:TETRAODON8:19:7259353:7268348:-1 gene:ENSTNIG00000003792 transcript:ENSTNIT00000002666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQKAQVVLFLDAKAVDSLQEGINFKRSPVNDKSYIIYKNRSSFKACKNQCKHQGGLFI
KDIEDLDGRTVKCTKHNWKLNLLTMKYINPPDSFIQDELEVELLDDGGLQLVELNPPDPW
MADPRECLVLKEGEVKVTYLTHACMELQLGERRFMFDPWLIGPAFARGWWLFHEPPADAL
DRLCAADLIYISHMHSDHLSYPTLRVLAERRPDAPIYVGDTSRPVFWYLEQSQVKLTNIN
VVPFGVWKNVDEHLRFMILMDGIHPELDTCIIIDYKGHMILNTVDCTRPNGGRLPKGVDL
MMSDFAGGASGFPMTFYGGKYSDSWKAHFIKKERKRLLSYKAELVKTLEPRIFCPFAGYF
VEAHPSDRYIRDTNIKNSAEDLNALINILRPDTVTWTPQPGSVLDLGLCLRDHTNREAII
FPPARTKMYKDSWDFHLYLDELSSAISSEIFRHKDWIQFYYTWAGFQNYNLVVRVIETDD
SFEPMSNGWDYLVDFLDLSFPTKRPEREHSYLELKNRISVMRYVVLHGCLWDDLYIGFQN
RISRDPDVYHHRFWNHFQTKLPVTRPEWDKFLKLKCGTGGPVISYECQ
Download sequence
Identical sequences H3BXM5
ENSTNIP00000000738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]