SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001438 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001438
Domain Number 1 Region: 45-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.95e-43
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 272-331
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000227
Family SAM (sterile alpha motif) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001438   Gene: ENSTNIG00000016062   Transcript: ENSTNIT00000001107
Sequence length 457
Comment pep:known_by_projection chromosome:TETRAODON8:13:11155590:11166252:-1 gene:ENSTNIG00000016062 transcript:ENSTNIT00000001107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIMDRTFPAGEENEDSGDEWDIGISYEKTSFVQQDLDAVASGKDDVMLKRAITNGDTETV
RQLLDKGLDVEMRLDFGWTPMCAVSVADYNVAELLLERGADASFHKADGWSVLMACITAS
AQEDRITRCVELLLSRNADPNVADRSQMTCLMLAAKRGHAKVINLLMVFGAEINAQDSYG
YTALSIAVQHRRQEAVLKLLQLGADKTIRTNTGKCPADLAAIFKNTEMSKILASSQPISA
SQASSSMENTLSQFFATSGEVSSAKECGRKLDELQLLLHGLDLGSLTDIMAKNDITWSHL
LSMDKEDLEEIGVTDPGDQQKVLDALRQMNLGKVDLETIDRFGGADSGSEELCNFLTIQD
VIGRIPCHPSKIAFALDPEKEAQTLCNQLVIQTGDLQKEVTCLRKLLCQLDHEECCQPPP
PEPCGPWGRQVLSGAALGVLGATCLLVLYGATSGCFT
Download sequence
Identical sequences H3BZM2
ENSTNIP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]