SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001578 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001578
Domain Number 1 Region: 772-837
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-20
Family TB module/8-cys domain 0.0000725
Further Details:      
 
Domain Number 2 Region: 258-322
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-17
Family TB module/8-cys domain 0.00051
Further Details:      
 
Domain Number 3 Region: 638-765
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.47e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 989-1042
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000157
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 5 Region: 427-548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000108
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 133-208
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000126
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 7 Region: 516-645
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000143
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 8 Region: 936-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 9 Region: 204-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000406
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 10 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 11 Region: 1097-1148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 12 Region: 886-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 13 Region: 6-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000122
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 1067-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001578   Gene: ENSTNIG00000010055   Transcript: ENSTNIT00000001518
Sequence length 1153
Comment pep:known_by_projection chromosome:TETRAODON8:7:5374467:5384291:1 gene:ENSTNIG00000010055 transcript:ENSTNIT00000001518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVCPLTCLNGGVCLSRKSCHCPPGFTGRLCQFPLTQTQQAQAARGNKQPVYPMSMKPDSL
KLVGETSIGRTQMTQTHSVFTLPLSQGPHAPEVPFNVRVHHPPDTSVVIYPLDQSDIKLP
HKSSPRIFFTRHKPKGRCFQETTPKQACNSTPLPVLTNQEDCCGSVGNSWGQNKCYQCPK
LPNAPVKQTIVEDSGTTCPQGYKRFNDTHCQDINECIMQVVCQNGDCLNTLGSFKCSCKA
GWVLEGNGCVVCPSEAPAEQGQCFLMASESRGCEHALPTYLTQDMCCCTVGKAWGPHCQP
CPQIGTVAFSKICPAGKGYFYKERTITCELLCKSHFLTVQPPETTTAVQQRPRVPGKLLS
GVRLVKKALGGKLSPCVVNMQIIMLYSHQTLSNSSVSIGPTVVKTTPHQVTIIRLTPDNV
PFETQTKVSDVDECKLNRNICGHGECESSLNGYVCHCHHGYHLNQIRNICEDNNECELEP
CGHGRGHCVNTDGSFKCLCRQGYKHMVQQGRPKCIDLNECSKQDICGVRGQCINLPGSYK
CECHGGFRIKSHRNPICEDVNECLNPDACPGELCENTVGSYECVPCLPGHEARGGTCFAD
INECLKPGMCPNGHCENLPGTYRCLCNEGFLPSSDSKGCSDINECEDFRLCANGRCINTE
GSFQCQCYSGFQRTQEGSHCEDINECERPSNCLRGRCINSMGSYHCECQKGYVLVGGRRC
QDVDECAADRNLCQPYGTCENRPGSYSCVCNHGYTLSENKRSCEAIRVFVEEKKECYLNL
DDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVSQSAEFHSLCPNGLGLYYDEGL
MYSLPAYHDIDECALFAEEICKRGHCENTLPGYECYCKKGFYYDSNLLECTDVNECHDES
LCAHGHCINTEGSFFCSCNQPWIPDANKKKCVLATVIDVNECEDPANCKNGRCVDTPGSY
YCICAPPWTLATDRNSCVTPEEQADRTAAHKDVCFLHVDEGLICSQPKNDMVVTYSQCCC
HYGRGWGPECNTCPPRHSGEQKSFWNSSPTPLVSDVFSPAGDSSEEDSDECSCANGRCVR
SYLGTMCECNTGFRLDYSRTRCLDIDECTEPGAGASPCKNSQCVNTAGSYKCFCKHGFVP
ARRPNICVHRRTR
Download sequence
Identical sequences H3C012
ENSTNIP00000001578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]