SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001681 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001681
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 145-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 258-372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001681   Gene: ENSTNIG00000014886   Transcript: ENSTNIT00000001517
Sequence length 376
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2325084:2327592:-1 gene:ENSTNIG00000014886 transcript:ENSTNIT00000001517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGLRVAALIYLLLLVDKADSKKDHKGFKCGGILSAPSSNISSPNFPSPYPYNSDCSWLI
VVAEGSSVHLTFHHFELEYHASCSYDYIKIYNGVAEDEGNLLGMFCGDVSPPQFTSSWNV
MSIIFHSDRHVAYRGFSVGYRKDMCGGVLTGLSGEISSPGYPLEYNNNADCTWTIRVSSA
SVVTLVFLDFQLENNEGCNFDFVALFDGPTVAHRHLGNYCGAAKPPHVVTTSNNLLVVFK
SDFNIGGRGFKAYYYSGECQQVLSAVSGTFSSPRFPNIYPNNINCHWGITQAAGYRVKLF
FPFMDLEDQNSLSGECDYDSVTVYDGDSQTDAVLGRWCGRERPPSLISRSNKLLVVLRTD
RNGAYRGFTAAYLGGK
Download sequence
Identical sequences H3C0B5
ENSTNIP00000004012 99883.ENSTNIP00000001681 ENSTNIP00000001681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]