SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001783 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001783
Domain Number 1 Region: 121-240
Classification Level Classification E-value
Superfamily EF-hand 1.07e-34
Family Osteonectin 0.028
Further Details:      
 
Domain Number 2 Region: 210-306
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.14e-27
Family Thyroglobulin type-1 domain 0.0007
Further Details:      
 
Domain Number 3 Region: 60-104
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000236
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001783   Gene: ENSTNIG00000000640   Transcript: ENSTNIT00000002157
Sequence length 366
Comment pep:known_by_projection chromosome:TETRAODON8:1:252939:269025:1 gene:ENSTNIG00000000640 transcript:ENSTNIT00000002157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DATKDPCLKVRCPPHRVCVSHDFQTAICTNRKQPAHRYVKPRKGSTGHKHRVEAGAHGKC
RLCSVLQSSPVCGSDGHSYSSKCKLEFQSCISGKSISVKCEGLCPCLPGRRAQNCSAQRT
GCTDSELHSLAARLKDWFRVLHLDANRDLKSSDNFDSTTGHFDTSILPICKDSLGWMFNK
LDINFDLLLDQSELSALYLDKYEMCMKPLFNSCDSFKDGKLSNNEWCYCFQKPEGLPCQS
EKTRVQAQSQRKTLIGSYIPRCTDEGYFKSTQCHSSTGQCWCVDKYGNEIAGSRKQGNPN
CDEDQETSGDFASGGGVILLDDQEEEPSQSGRSRQKKRRGRIHPRGTIEDDEDEEDDKDD
ETGYTW
Download sequence
Identical sequences H3C0L7
ENSTNIP00000001783 99883.ENSTNIP00000001783 ENSTNIP00000001783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]